Property Summary

NCBI Gene PubMed Count 44
PubMed Score 78.39
PubTator Score 42.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.1e-51

Protein-protein Interaction (1)

Gene RIF (29)

AA Sequence

MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLI      1 - 70
QVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDA     71 - 140
AQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFDVDSKPLKTLE    141 - 210
DALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLD    211 - 280
FSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT    281 - 350
YGNPNYHWQETAYLLVYMKMEC                                                    351 - 372
//

Text Mined References (45)

PMID Year Title