Property Summary

NCBI Gene PubMed Count 35
Grant Count 35
R01 Count 34
Funding $3,323,960.06
PubMed Score 68.21
PubTator Score 42.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.000

Gene RIF (21)

PMID Text
26240016 USP18 negatively regulates NF-kappaB signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26116899 HIV-1 Vpr upregulates the gene expression of USP18 in human monocyte-derived dendritic cells
26046984 Data suggest that USP18 (Ubiquitin-like specific protease 18) sensitive cellular functions include activity of the peptide transporters PEPT1 and PEPT2.
26008745 Dimerization of IFNAR1 and IFNAR2 and the limiting role of IFNAR1 binding affinity in complex assembly is modulated by USP18.
24955730 increased expression in the HIV+/HCV+ female patients group compared with HIV-/HCV+ and HIV+/HCV- groups
24742347 HIV-1 Vpr upregulates the gene expression of USP18 in human monocyte-derived dendritic cells
23700969 USP18 expression levels induced by IFNbeta did not differ amongst multiple sclerosis patients carrying different rs2542109 genotypes
23291318 Usp18 upregulation was associated with Wilms Tumor.
23152055 USP18 inhibition induces inflammation by increasing the STAT signaling and exacerbates IFN-induced beta cell apoptosis.
22752428 A direct relationship was found between UBP43 and cyclin D1 (but not cyclin E) expression.
More...

AA Sequence

MSKAFGLLRQICQSILAESSQSPADLEEKKEEDSNMKREQPRERPRAWDYPHGLVGLHNIGQTCCLNSLI      1 - 70
QVFVMNVDFTRILKRITVPRGADEQRRSVPFQMLLLLEKMQDSRQKAVRPLELAYCLQKCNVPLFVQHDA     71 - 140
AQLYLKLWNLIKDQITDVHLVERLQALYTIRVKDSLICVDCAMESSRNSSMLTLPLSLFDVDSKPLKTLE    141 - 210
DALHCFFQPRELSSKSKCFCENCGKKTRGKQVLKLTHLPQTLTIHLMRFSIRNSQTRKICHSLYFPQSLD    211 - 280
FSQILPMKRESCDAEEQSGGQYELFAVIAHVGMADSGHYCVYIRNAVDGKWFCFNDSNICLVSWEDIQCT    281 - 350
YGNPNYHWQETAYLLVYMKMEC                                                    351 - 372
//

Text Mined References (36)

PMID Year Title
26240016 2015 USP18 negatively regulates NF-?B signaling by targeting TAK1 and NEMO for deubiquitination through distinct mechanisms.
26046984 2015 USP18 Sensitivity of Peptide Transporters PEPT1 and PEPT2.
26008745 2015 Receptor dimerization dynamics as a regulatory valve for plasticity of type I interferon signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24955730 2014 Systemic cytokine and interferon responsiveness Patterns in HIV and HCV mono and co-infections.
23700969 2013 Roles of the ubiquitin peptidase USP18 in multiple sclerosis and the response to interferon-? treatment.
23291318 2013 Ubiquitin specific protease 18 (Usp18) is a WT1 transcriptional target.
23152055 2012 USP18 is a key regulator of the interferon-driven gene network modulating pancreatic beta cell inflammation and apoptosis.
22752428 2012 Evidence for the ubiquitin protease UBP43 as an antineoplastic target.
22731491 2012 USP18 establishes the transcriptional and anti-proliferative interferon ?/? differential.
More...