Property Summary

NCBI Gene PubMed Count 26
PubMed Score 25.63
PubTator Score 22.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Epithelial ovarian cancer 19
Disease Target Count P-value
breast carcinoma 1614 7.56288645474071E-34
non-small cell lung cancer 2798 4.60641826337841E-15
juvenile dermatomyositis 1189 1.31401060198702E-13
posterior fossa group B ependymoma 1530 3.34172915964558E-13
acute quadriplegic myopathy 1157 3.08588628079353E-12
ovarian cancer 8492 2.27582199592032E-11
Amyotrophic Lateral Sclerosis 432 2.05741034128903E-9
atypical teratoid/rhabdoid tumor 1095 5.16153095261577E-7
lung adenocarcinoma 2714 5.74196077629792E-6
lung carcinoma 2844 9.77163926549053E-6
psoriasis 6685 1.0196137569989E-5
Pick disease 1893 1.74397924522468E-5
invasive ductal carcinoma 2950 1.06330202431396E-4
primitive neuroectodermal tumor 3031 1.36334859910731E-4
ductal carcinoma in situ 1745 1.78937399894341E-4
medulloblastoma, large-cell 6234 2.66248037930883E-4
pilocytic astrocytoma 3086 3.35317900557097E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.97489279040431E-4
group 4 medulloblastoma 1875 6.87812883470656E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 8.28520362159994E-4
primary Sjogren syndrome 789 9.61610876666443E-4
nasopharyngeal carcinoma 1056 0.00143770515241416
adrenocortical carcinoma 1427 0.00150439252259549
pituitary cancer 1972 0.00156473874410083
pancreatic cancer 2300 0.0021198602732785
osteosarcoma 7933 0.00292326839384206
Atopic dermatitis 944 0.00401270776861417
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00483497352005304
pediatric high grade glioma 2712 0.00528364027998664
primary pancreatic ductal adenocarcinoma 1271 0.00670945315538338
progressive supranuclear palsy 674 0.00803421154096866
glioblastoma 5572 0.0202938039922894
Breast cancer 3099 0.0238523710285762
X-linked recessive Emery-Dreifuss muscular dystrophy 18 0.0281697579992604
hereditary spastic paraplegia 313 0.0316873335364697
spina bifida 1064 0.0392108993611066
aldosterone-producing adenoma 664 0.0491390568564793
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

 MGI Term (1)

Pathway (1)

Gene RIF (9)

PMID Text
25918983 Promoter hypermethylation and down regulation of SYNPO2 has significance in the prognosis of melanoma patients.
25883213 High Synaptopodin-2 induces assembly of peripheral actin bundles and immature focal adhesions to promote lamellipodia formation and prostate cancer cell migration.
22252522 myopodin is epigenetically modified in colon cancer
21643011 the N-terminus of myopodin binds integrin-linked kinase (ILK) both in vivo and in vitro
20332099 Observational study of gene-disease association. (HuGE Navigator)
19360353 The subcellular localization of myopodin is involved in its suppressor or activator function in tumorigenesis.
18371299 The myopodin new isoform (Myo2), in addition to the two predicted isoforms (Myo1 and Myo3), are transcribed in various mammalian tumor cell lines.
17828378 Imp13 functions in myopodin import and the regulation of this event is critical for normal and abnormal cellular differentiation.
15111326 myopodin functions as a tumor suppressor gene to limit the growth and to inhibit the metastasis of cancer cells

AA Sequence

MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAKIRNQSKASGSGLCEGDEVVSINGNPCADLTYPEVI      1 - 70
KLMESITDSLQMLIKRPSSGISEALISENENKNLEHLTHGGYVESTTLQIRPATKTQCTEFFLAPVKTEV     71 - 140
PLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKG    141 - 210
ASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAG    211 - 280
LPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHK    281 - 350
HRARHARLRRSESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRARKYTLVSYGTGELERE    351 - 420
ADEEEEGDKEDTCEVAFLGASESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKKLNRGDKMEMLPDTTGK    421 - 490
GALMFAKRRERMDQITAQKEEDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHG    491 - 560
LGHVPQQNGFSGTSETANIQRMVPMNRTAKPFPGSVNQPATPFSPTRNMTSPIADFPAPPPYSAVTPPPD    561 - 630
AFSRGVSSPIAGPAQPPPWPQPAPWSQPAFYDSSERIASRDERISVPAKRTGILQEAKRRSTTKPMFTFK    631 - 700
EPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKQKTPPPVAPKPAVKSSSS    701 - 770
QPVTPVSPVWSPGVAPTQPPAFPTSNPSKGTVVSSIKIAQPSYPPARPASTLNVAGPFKGPQAAVASQNY    771 - 840
TPKPTVSTPTVNAVQPGAVGPSNELPGMSGRGAQLFAKRQSRMEKYVVDSDTVQAHAARAQSPTPSLPAS    841 - 910
WKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAAQPSKMGKKKGKKPLNALDVMKHQPYQLNASLFTFQ    911 - 980
PPDAKDGLPQKSSVKVNSALAMKQALPPRPVNAASPTNVQASSVYSVPAYTSPPSFFAEASSPVSASPVP    981 - 1050
VGIPTSPKQESASSSYFVAPRPKFSAKKSGVTIQVWKPSVVEE                              1051 - 1093
//

Text Mined References (31)

PMID Year Title
25918983 2015 Prognostic Significance of Promoter Hypermethylation and Diminished Gene Expression of SYNPO2 in Melanoma.
25883213 2015 Synaptopodin-2 induces assembly of peripheral actin bundles and immature focal adhesions to promote lamellipodia formation and prostate cancer cell migration.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24005909 2013 Prostate cancer cell migration induced by myopodin isoforms is associated with formation of morphologically and biochemically distinct actin networks.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
22915763 2012 Myopodin isoforms alter the chemokinetic response of PC3 cells in response to different migration stimuli via differential effects on Rho-ROCK signaling pathways.
22252522 2012 Diagnostic and prognostic utility of methylation and protein expression patterns of myopodin in colon cancer.
21643011 2011 Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...