Property Summary

NCBI Gene PubMed Count 30
PubMed Score 27.86
PubTator Score 22.77

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Ovarian epithelial cancer 10 0.0 0.0
Disease Target Count
Epithelial ovarian cancer 9
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Melanoma 711 0.0 0.5
Skin cancer 469 0.0 0.6

Expression

  Differential Expression (37)

Disease log2 FC p
acute quadriplegic myopathy 2.851 3.1e-12
adrenocortical carcinoma -1.540 1.5e-03
adult high grade glioma -1.300 3.0e-03
aldosterone-producing adenoma -1.167 4.9e-02
Amyotrophic lateral sclerosis 1.548 2.1e-09
Astrocytoma, Pilocytic -1.300 4.2e-04
Atopic dermatitis -1.400 4.2e-03
atypical teratoid / rhabdoid tumor -1.800 1.7e-08
autosomal dominant Emery-Dreifuss muscul... 1.233 1.0e-04
Breast cancer -4.200 2.4e-02
breast carcinoma -1.300 3.4e-04
ductal carcinoma in situ -1.800 6.1e-04
ependymoma 1.500 3.9e-02
glioblastoma -1.400 2.6e-06
group 3 medulloblastoma -1.100 4.5e-02
hereditary spastic paraplegia -1.240 3.2e-02
intraductal papillary-mucinous adenoma (... -2.100 1.4e-03
intraductal papillary-mucinous carcinoma... -2.700 1.0e-03
intraductal papillary-mucinous neoplasm ... -2.900 3.0e-03
invasive ductal carcinoma -2.900 1.0e-04
juvenile dermatomyositis 1.866 2.3e-12
lung adenocarcinoma -1.500 2.2e-09
lung carcinoma -1.200 9.8e-06
medulloblastoma, large-cell -1.500 5.2e-03
nasopharyngeal carcinoma 1.500 5.9e-04
non-small cell lung cancer -2.187 4.7e-20
osteosarcoma 1.703 2.9e-03
ovarian cancer -1.700 1.0e-06
pancreatic cancer 1.400 2.1e-03
pancreatic ductal adenocarcinoma liver m... -1.029 5.0e-02
Pick disease 1.900 1.7e-05
pituitary cancer -1.400 3.3e-03
primary Sjogren syndrome 1.200 9.6e-04
primitive neuroectodermal tumor -1.800 1.4e-04
progressive supranuclear palsy 1.200 8.0e-03
psoriasis -1.400 6.5e-19
spina bifida -2.608 3.6e-02

Gene RIF (13)

AA Sequence

MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAKIRNQSKASGSGLCEGDEVVSINGNPCADLTYPEVI      1 - 70
KLMESITDSLQMLIKRPSSGISEALISENENKNLEHLTHGGYVESTTLQIRPATKTQCTEFFLAPVKTEV     71 - 140
PLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKG    141 - 210
ASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAG    211 - 280
LPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHK    281 - 350
HRARHARLRRSESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRARKYTLVSYGTGELERE    351 - 420
ADEEEEGDKEDTCEVAFLGASESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKKLNRGDKMEMLPDTTGK    421 - 490
GALMFAKRRERMDQITAQKEEDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHG    491 - 560
LGHVPQQNGFSGTSETANIQRMVPMNRTAKPFPGSVNQPATPFSPTRNMTSPIADFPAPPPYSAVTPPPD    561 - 630
AFSRGVSSPIAGPAQPPPWPQPAPWSQPAFYDSSERIASRDERISVPAKRTGILQEAKRRSTTKPMFTFK    631 - 700
EPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKQKTPPPVAPKPAVKSSSS    701 - 770
QPVTPVSPVWSPGVAPTQPPAFPTSNPSKGTVVSSIKIAQPSYPPARPASTLNVAGPFKGPQAAVASQNY    771 - 840
TPKPTVSTPTVNAVQPGAVGPSNELPGMSGRGAQLFAKRQSRMEKYVVDSDTVQAHAARAQSPTPSLPAS    841 - 910
WKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAAQPSKMGKKKGKKPLNALDVMKHQPYQLNASLFTFQ    911 - 980
PPDAKDGLPQKSSVKVNSALAMKQALPPRPVNAASPTNVQASSVYSVPAYTSPPSFFAEASSPVSASPVP    981 - 1050
VGIPTSPKQESASSSYFVAPRPKFSAKKSGVTIQVWKPSVVEE                              1051 - 1093
//

Text Mined References (39)

PMID Year Title