Property Summary

NCBI Gene PubMed Count 26
Grant Count 18
R01 Count 17
Funding $1,311,283.04
PubMed Score 25.63
PubTator Score 22.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25918983 Promoter hypermethylation and down regulation of SYNPO2 has significance in the prognosis of melanoma patients.
25883213 High Synaptopodin-2 induces assembly of peripheral actin bundles and immature focal adhesions to promote lamellipodia formation and prostate cancer cell migration.
22252522 myopodin is epigenetically modified in colon cancer
21643011 the N-terminus of myopodin binds integrin-linked kinase (ILK) both in vivo and in vitro
20332099 Observational study of gene-disease association. (HuGE Navigator)
19360353 The subcellular localization of myopodin is involved in its suppressor or activator function in tumorigenesis.
18371299 The myopodin new isoform (Myo2), in addition to the two predicted isoforms (Myo1 and Myo3), are transcribed in various mammalian tumor cell lines.
17828378 Imp13 functions in myopodin import and the regulation of this event is critical for normal and abnormal cellular differentiation.
15111326 myopodin functions as a tumor suppressor gene to limit the growth and to inhibit the metastasis of cancer cells

AA Sequence

MGTGDFICISMTGGAPWGFRLQGGKEQKQPLQVAKIRNQSKASGSGLCEGDEVVSINGNPCADLTYPEVI      1 - 70
KLMESITDSLQMLIKRPSSGISEALISENENKNLEHLTHGGYVESTTLQIRPATKTQCTEFFLAPVKTEV     71 - 140
PLAENQRSGPDCAGSLKEETGPSYQRAPQMPDSQRGRVAEELILREKVEAVQPGPVVELQLSLSQERHKG    141 - 210
ASGPLVALPGAEKSKSPDPDPNLSHDRIVHINSIPTNEKADPFLRSSKIIQISSGRELRVIQESEAGDAG    211 - 280
LPRVEVILDCSDRQKTEGCRLQAGKECVDSPVEGGQSEAPPSLVSFAVSSEGTEQGEDPRSEKDHSRPHK    281 - 350
HRARHARLRRSESLSEKQVKEAKSKCKSIALLLTDAPNPNSKGVLMFKKRRRRARKYTLVSYGTGELERE    351 - 420
ADEEEEGDKEDTCEVAFLGASESEVDEELLSDVDDNTQVVNFDWDSGLVDIEKKLNRGDKMEMLPDTTGK    421 - 490
GALMFAKRRERMDQITAQKEEDKVGGTPSREQDAAQTDGLRTTTSYQRKEEESVRTQSSVSKSYIEVSHG    491 - 560
LGHVPQQNGFSGTSETANIQRMVPMNRTAKPFPGSVNQPATPFSPTRNMTSPIADFPAPPPYSAVTPPPD    561 - 630
AFSRGVSSPIAGPAQPPPWPQPAPWSQPAFYDSSERIASRDERISVPAKRTGILQEAKRRSTTKPMFTFK    631 - 700
EPKVSPNPELLSLLQNSEGKRGTGAGGDSGPEEDYLSLGAEACNFMQSSSAKQKTPPPVAPKPAVKSSSS    701 - 770
QPVTPVSPVWSPGVAPTQPPAFPTSNPSKGTVVSSIKIAQPSYPPARPASTLNVAGPFKGPQAAVASQNY    771 - 840
TPKPTVSTPTVNAVQPGAVGPSNELPGMSGRGAQLFAKRQSRMEKYVVDSDTVQAHAARAQSPTPSLPAS    841 - 910
WKYSSNVRAPPPVAYNPIHSPSYPLAALKSQPSAAQPSKMGKKKGKKPLNALDVMKHQPYQLNASLFTFQ    911 - 980
PPDAKDGLPQKSSVKVNSALAMKQALPPRPVNAASPTNVQASSVYSVPAYTSPPSFFAEASSPVSASPVP    981 - 1050
VGIPTSPKQESASSSYFVAPRPKFSAKKSGVTIQVWKPSVVEE                              1051 - 1093
//

Text Mined References (31)

PMID Year Title
25918983 2015 Prognostic Significance of Promoter Hypermethylation and Diminished Gene Expression of SYNPO2 in Melanoma.
25883213 2015 Synaptopodin-2 induces assembly of peripheral actin bundles and immature focal adhesions to promote lamellipodia formation and prostate cancer cell migration.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24005909 2013 Prostate cancer cell migration induced by myopodin isoforms is associated with formation of morphologically and biochemically distinct actin networks.
23967269 2013 A genome-wide association study of total serum and mite-specific IgEs in asthma patients.
22915763 2012 Myopodin isoforms alter the chemokinetic response of PC3 cells in response to different migration stimuli via differential effects on Rho-ROCK signaling pathways.
22252522 2012 Diagnostic and prognostic utility of methylation and protein expression patterns of myopodin in colon cancer.
21643011 2011 Phosphorylation and interaction of myopodin by integrin-link kinase lead to suppression of cell growth and motility in prostate cancer cells.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
More...