Property Summary

NCBI Gene PubMed Count 51
PubMed Score 54.25
PubTator Score 59.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Disease Progression 136 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count P-value
psoriasis 6694 3.8e-06
malignant mesothelioma 3232 1.3e-05
osteosarcoma 7950 3.8e-04
lung cancer 4740 6.8e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Retinitis pigmentosa 19 4 4.952 2.5

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 6.8e-03
malignant mesothelioma 1.400 1.3e-05
osteosarcoma 1.360 3.8e-04
psoriasis 3.600 3.8e-06

Gene RIF (29)

AA Sequence

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATS      1 - 70
IPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL     71 - 140
IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQV    141 - 210
ASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF    211 - 280
SASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG    281 - 350
CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD    351 - 420
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFI    421 - 490
ASTGMDRSLKFYSL                                                            491 - 504
//

Text Mined References (57)

PMID Year Title