Property Summary

NCBI Gene PubMed Count 44
Grant Count 29
R01 Count 19
Funding $1,652,278.3
PubMed Score 50.28
PubTator Score 59.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis 3.600 0.000
osteosarcoma 1.360 0.000
lung cancer 1.100 0.007

Gene RIF (22)

PMID Text
24731397 We report that PRP19 expression is elevated in lung carcinoma tissues compared to non-tumor tissues
24718257 These findings suggest that SKAP promotes ultraviolet rays-induced cell apoptosis by negatively regulating the anti-apoptotic protein Prp19.
24675077 involvement of hPso4 in the recombinational repair of DSBs
24598747 The Prp19-CDC5L complex plays a crucial role during human pre-mRNA splicing by catalytic activation of the spliceosome.
24587161 DNA damage induces down-regulation of Prp19 via impairing Prp19 stability in hepatocellular carcinoma cells.
24332808 PRP19 directly binds RPA and localizes to DNA damage sites via RPA, promoting RPA ubiquitylation in a DNA-damage-induced manner.
24069358 Prp19 complex as the first spliceosome subcomplex that directly contributes to mitosis in vertebrates independently of its function in interphase.
23220010 PRP19 over-expression is associated with hepatocellular carcinoma recurrence.
22967061 New insights into pre-mRNA processing factor 19
22529335 SNEV phosphorylation at S149 is essential for mediating the cytoprotective effect of SNEV upon DNA damage/oxidative stress and partially contributes to the life span extension caused by SNEV overexpression.
More...

AA Sequence

MSLICSISNEVPEHPCVSPVSNHVYERRLIEKYIAENGTDPINNQPLSEEQLIDIKVAHPIRPKPPSATS      1 - 70
IPAILKALQDEWDAVMLHSFTLRQQLQTTRQELSHALYQHDAACRVIARLTKEVTAAREALATLKPQAGL     71 - 140
IVPQAVPSSQPSVVGAGEPMDLGELVGMTPEIIQKLQDKATVLTTERKKRGKTVPEELVKPEELSKYRQV    141 - 210
ASHVGLHSASIPGILALDLCPSDTNKILTGGADKNVVVFDKSSEQILATLKGHTKKVTSVVFHPSQDLVF    211 - 280
SASPDATIRIWSVPNASCVQVVRAHESAVTGLSLHATGDYLLSSSDDQYWAFSDIQTGRVLTKVTDETSG    281 - 350
CSLTCAQFHPDGLIFGTGTMDSQIKIWDLKERTNVANFPGHSGPITSIAFSENGYYLATAADDSSVKLWD    351 - 420
LRKLKNFKTLQLDNNFEVKSLIFDQSGTYLALGGTDVQIYICKQWTEILHFTEHSGLTTGVAFGHHAKFI    421 - 490
ASTGMDRSLKFYSL                                                            491 - 504
//

Text Mined References (50)

PMID Year Title
24731397 2014 PRP19 upregulation inhibits cell proliferation in lung adenocarcinomas by p21-mediated induction of cell cycle arrest.
24718257 2014 Small kinetochore associated protein (SKAP) promotes UV-induced cell apoptosis through negatively regulating pre-mRNA processing factor 19 (Prp19).
24675077 2014 The role of the human psoralen 4 (hPso4) protein complex in replication stress and homologous recombination.
24598747 2014 Structural insights into the novel ARM-repeat protein CTNNBL1 and its association with the hPrp19-CDC5L complex.
24587161 2014 DNA damage induces down-regulation of Prp19 via impairing Prp19 stability in hepatocellular carcinoma cells.
24332808 2014 PRP19 transforms into a sensor of RPA-ssDNA after DNA damage and drives ATR activation via a ubiquitin-mediated circuitry.
24069358 2013 The Prp19 complex directly functions in mitotic spindle assembly.
23220010 2013 Ubiquitin C-terminal Hydrolase 37, a novel predictor for hepatocellular carcinoma recurrence, promotes cell migration and invasion via interacting and deubiquitinating PRP19.
22967061 2012 New insights into pre-mRNA processing factor 19: A multi-faceted protein in humans.
22961380 2012 Human CWC22 escorts the helicase eIF4AIII to spliceosomes and promotes exon junction complex assembly.
More...