Property Summary

NCBI Gene PubMed Count 26
PubMed Score 111.84
PubTator Score 44.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer 1.200 9.9e-04
malignant mesothelioma 1.700 1.2e-07

Gene RIF (5)

AA Sequence

MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTV      1 - 70
LDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQM     71 - 140
GQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVW    141 - 210
RKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAG    211 - 280
ISHTAWHSNRTLYETCIEPWLS                                                    281 - 302
//

Text Mined References (29)

PMID Year Title