Property Summary

NCBI Gene PubMed Count 26
Grant Count 31
R01 Count 10
Funding $5,000,110.73
PubMed Score 109.46
PubTator Score 44.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
lung cancer 1.200 0.001

Gene RIF (5)

PMID Text
24387323 We identified that PPT2 on chromosome 6p21 is associated with loss of lung function in the Korean population.
20010835 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19143821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
12855696 The crystal structure of palmitoyl protein thioesterase-2 (PPT2) reveals the basis for divergent substrate specificities of the two lysosomal thioesterases, PPT1 and PPT2.

AA Sequence

MLGLCGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRHLLEYINETHPGTVVTV      1 - 70
LDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQGGLVCRALLSVMDDHNVDSFISLSSPQM     71 - 140
GQYGDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVW    141 - 210
RKNFLRVGHLVLIGGPDDGVITPWQSSFFGFYDANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAG    211 - 280
ISHTAWHSNRTLYETCIEPWLS                                                    281 - 302
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24387323 2014 Genome-wide association studies identify locus on 6p21 influencing lung function in the Korean population.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
21269460 2011 Initial characterization of the human central proteome.
20010835 2010 Meta-analyses of genome-wide association studies identify multiple loci associated with pulmonary function.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19143821 2009 Association of MHC SNP genotype with susceptibility to type 1 diabetes: a modified survival approach.
More...