Property Summary

NCBI Gene PubMed Count 30
PubMed Score 63.27
PubTator Score 33.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Atrial Septal Defect 4 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.8e-10
Disease Target Count Z-score Confidence
Heart disease 306 0.0 3.0
Osteoporosis 363 0.0 0.7
Disease Target Count Z-score Confidence
Cardiomyopathy 116 3.243 1.6
Atrial heart septal defect 18 0.0 4.0
Disease Target Count Z-score Confidence
Congenital heart disease 93 5.457 2.7

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 3.100 2.8e-10

 GO Component (2)

Gene RIF (24)

AA Sequence

MEFTASPKPQLSSRANAFSIAALMSSGGSKEKEATENTIKPLEQFVEKSSCAQPLGELTSLDAHGEFGGG      1 - 70
SGSSPSSSSLCTEPLIPTTPIIPSEEMAKIACSLETKELWDKFHELGTEMIITKSGRRMFPTIRVSFSGV     71 - 140
DPEAKYIVLMDIVPVDNKRYRYAYHRSSWLVAGKADPPLPARLYVHPDSPFTGEQLLKQMVSFEKVKLTN    141 - 210
NELDQHGHIILNSMHKYQPRVHIIKKKDHTASLLNLKSEEFRTFIFPETVFTAVTAYQNQLITKLKIDSN    211 - 280
PFAKGFRDSSRLTDIERESVESLIQKHSYARSPIRTYGGEEDVLGDESQTTPNRGSAFTTSDNLSLSSWV    281 - 350
SSSSSFPGFQHPQSLTALGTSTASIATPIPHPIQGSLPPYSRLGMPLTPSAIASSMQGSGPTFPSFHMPR    351 - 420
YHHYFQQGPYAAIQGLRHSSAVMTPFV                                               421 - 447
//

Text Mined References (30)

PMID Year Title