Property Summary

NCBI Gene PubMed Count 19
Grant Count 3
Funding $54,543
PubMed Score 5.82
PubTator Score 33.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
medulloblastoma 1.400 0.000
medulloblastoma, large-cell 1.100 0.001
primitive neuroectodermal tumor 1.400 0.001
tuberculosis and treatment for 6 months 1.200 0.000
Breast cancer -1.300 0.000

Synonym

Accession Q9UMR2 B3KNE9 B4DXS6 E7EMK4 Q6FIB7 Q6IAE0 Q96KE7 Q9H0U0
Symbols DBP5
RNAh
DDX19

Gene

PDB

3EWS   3FHC   3FHT   3FMO   3FMP   3G0H  

Gene RIF (5)

PMID Text
25585691 Ddx19 is an RNA export factor required for nuclear import of the SRF coactivator MKL1
22064466 Dbp5, Gle1-IP6 and Nup159: a working model for mRNP export.
19244245 Results describe the crystal structures of human DDX19, a DEXD/H-box protein, in its open and closed cleft conformations.
19219046 Using in vitro assays, the authors demonstrate that NUP214 decreases both the RNA binding and ATPase activities of DBP5.
12219940 identification and characterization of a gene coding a novel isoform

AA Sequence

MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNL      1 - 70
VDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQS     71 - 140
GTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKIS    141 - 210
EQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDS    211 - 280
VWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA    281 - 350
AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN    351 - 420
ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN               421 - 479
//

Text Mined References (22)

PMID Year Title
25585691 2015 RNA export factor Ddx19 is required for nuclear import of the SRF coactivator MKL1.
25416956 2014 A proteome-scale map of the human interactome network.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22064466 Dbp5, Gle1-IP6 and Nup159: a working model for mRNP export.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19244245 2009 The DEXD/H-box RNA helicase DDX19 is regulated by an {alpha}-helical switch.
19219046 2009 The mRNA export protein DBP5 binds RNA and the cytoplasmic nucleoporin NUP214 in a mutually exclusive manner.
19208808 2009 Structural and functional analysis of the interaction between the nucleoporin Nup214 and the DEAD-box helicase Ddx19.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...