Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.06
PubTator Score 33.01

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer -1.300 2.4e-24
group 4 medulloblastoma 1.300 1.7e-05
medulloblastoma, large-cell 1.100 8.1e-04
primitive neuroectodermal tumor 1.400 6.7e-04
tuberculosis and treatment for 6 months 1.200 8.9e-06

Gene RIF (6)

AA Sequence

MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNL      1 - 70
VDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQS     71 - 140
GTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKIS    141 - 210
EQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDS    211 - 280
VWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA    281 - 350
AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN    351 - 420
ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN               421 - 479
//

Text Mined References (23)

PMID Year Title