Property Summary

NCBI Gene PubMed Count 10
Grant Count 27
R01 Count 18
Funding $2,221,074.14
PubMed Score 18.88
PubTator Score 6.87

Knowledge Summary

Patent

No data available

Expression

Gene RIF (2)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)
14744868 BARX2 can coordinate the expression of a network of genes that influence the growth of tumor cells

AA Sequence

MHCHAELRLSSPGQLKAARRRYKTFMIDEILSKETCDYFEKLSLYSVCPSLVVRPKPLHSCTGSPSLRAY      1 - 70
PLLSVITRQPTVISHLVPATPGIAQALSCHQVTEAVSAEAPGGEALASSESETEQPTPRQKKPRRSRTIF     71 - 140
TELQLMGLEKKFQKQKYLSTPDRLDLAQSLGLTQLQVKTWYQNRRMKWKKMVLKGGQEAPTKPKGRPKKN    141 - 210
SIPTSEEIEAEEKMNSQAQGQEQLEPSQGQEELCEAQEPKARDVPLEMAEPPDPPQELPIPSSEPPPLS     211 - 279
//

Text Mined References (12)

PMID Year Title
22383897 2012 Genome-wide association study in east Asians identifies novel susceptibility loci for breast cancer.
22238593 2012 A genome-wide association search for type 2 diabetes genes in African Americans.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14744868 2004 Identification of novel binding elements and gene targets for the homeodomain protein BARX2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278942 2001 Identification of Barx2b, a serum response factor-associated homeodomain protein.
10854790 2000 Cloning and chromosomal localization of the human BARX2 homeobox protein gene.
More...