Property Summary

NCBI Gene PubMed Count 21
PubMed Score 8.15
PubTator Score 6.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
psoriasis -2.200 2.6e-05
active Crohn's disease -1.043 2.0e-02
adult high grade glioma -1.600 5.0e-06
Astrocytoma, Pilocytic -1.300 2.3e-07
atypical teratoid / rhabdoid tumor -2.100 7.6e-08
glioblastoma -1.100 1.3e-04
group 3 medulloblastoma -1.300 4.5e-04
medulloblastoma, large-cell -2.500 9.3e-07
osteosarcoma -1.497 2.0e-05
primitive neuroectodermal tumor -1.500 4.2e-04
subependymal giant cell astrocytoma -1.305 2.1e-02

Gene RIF (9)

AA Sequence

MGKPSSMDTKFKDDLFRKYVQFHESKVDTTTSRQRPGSDECLRVAASTLLSLHKVDPFYRFRLIQFYEVV      1 - 70
ESSLRSLSSSSLRALHGAFSMLETVGINLFLYPWKKEFRSIKTYTGPFVYYVKSTLLEEDIRAILSCMGY     71 - 140
TPELGTAYKLRELVETLQVKMVSFELFLAKVECEQMLEIHSQVKDKGYSELDIVSERKSSAEDVRGCSDA    141 - 210
LRRRAEGREHLTASMSRVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLRKEPVA    211 - 280
TDVGDDLKDEIIRPSPSLLTMASSPHGSPDVLPPASPSNGPALLRGTYFSTQDDVDLYTDSEPRATYRRQ    281 - 350
DALRPDVWLLRNDAHSLYHKRSPPAKESALSKCQSCGLSCSSSLCQRCDSLLTCPPASKPSAFPSKASTH    351 - 420
DSLAHGASLREKYPGQTQGLDRLPHLHSKSKPSTTPTSRCGFCNRPGATNTCTQCSKVSCDACLSAYHYD    421 - 490
PCYKKSELHKFMPNNQLNYKSTQLSHLVYR                                            491 - 520
//

Text Mined References (25)

PMID Year Title