Property Summary

NCBI Gene PubMed Count 443
Grant Count 246
R01 Count 127
Funding $30,377,277.77
PubMed Score 2621.65
PubTator Score 1838.90

Knowledge Summary

Patent (521,333)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.161 0.000
lung cancer -2.000 0.001
non primary Sjogren syndrome sicca -1.300 0.023
Breast cancer -1.200 0.000
ovarian cancer -1.100 0.001
pituitary cancer -1.900 0.000

Synonym

Accession Q9UM73 Q4ZFX9 Q53QQ6 Q53RZ4 Q59FI3 Q9Y4K6
Symbols CD246
NBLST3

Gene

ALK

PDB

2KUP   2KUQ   2YS5   2YT2   2XB7   2XBA   2XP2   2YFX   2YHV   2YJR   2YJS   3AOX   3L9P   3LCS   3LCT   4ANL   4ANQ   4ANS   4CCB   4CCU   4CD0   4CLI   4CLJ   4CMO   4CMT   4CMU   4CNH   4CTB   4CTC   4DCE   4FNW   4FNX   4FNY   4FNZ   4FOB   4FOC   4FOD   4JOA   4MKC   4TT7   4Z55   5A9U   5AA8   5AA9   5AAA   5AAB   5AAC   5FTO   5FTQ   5IMX   5IUG   5IUH   5IUI   5J7H   5KZ0  

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (425)

PMID Text
26966027 Data show that anaplastic lymphoma kinase (ALKinhibitor ASP3026 was well tolerated with no treatment-related deaths.
26951079 Studies indicate the role of anaplastic lymphoma kinase (ALK) in malignant proliferation and as a valid drug target.
26857243 TERT promoter mutation is an independent predictor for distant metastasis of thyroid neoplasms, but ALK testing is not useful for clinical decision-making in Korean patients with a high prevalence of the BRAF V600E mutation.
26825369 Meta-analysis: immunohistochemistry assay using D5F3 and 5A4 antibodies reliably detected NSCLC with ALK rearrangement and may be useful as a screening method to identify these tumors.
26823889 Case Report: Epithelioid inflammatory myofibroblastic sarcoma treated with ALK inhibitor.
26755435 This review describes the biology of EML4 and ALK, explains the main features of EML4-ALK fusion proteins and outline the therapies that target EML4-ALK in cancer. [review]
26719536 Rather than by secondary ALK mutations.
26687816 ALK activation in tumors was associated with favorable features, including a younger age at diagnosis, hyperdiploidy, and detection by mass screening
26630010 Data show FAM150B, which was named as augmentor-alpha (AUG-alpha), binds and activtes both anaplastic lymphoma kinase (ALK) and tyrosine kinase (LTK).
26618223 We will also provide a timely review on all ALK inhibitors and their current status of development in clinical settings
More...

AA Sequence

MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARD      1 - 70
LLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQ     71 - 140
LVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRA    141 - 210
SQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPL    211 - 280
HDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS    281 - 350
VHRHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF    351 - 420
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWT    421 - 490
QGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCELRMSWLIRGVL    491 - 560
RGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWGQGSRAIVAFDNISI    561 - 630
SLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQ    631 - 700
CNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDM    701 - 770
LYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII    771 - 840
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAM    841 - 910
KKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVN    911 - 980
IKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVL    981 - 1050
AFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIR   1051 - 1120
GLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSL   1121 - 1190
PRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP   1191 - 1260
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPY   1261 - 1330
PSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE   1331 - 1400
YGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPA   1401 - 1470
VEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCT   1471 - 1540
VPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILK   1541 - 1610
SKNSMNQPGP                                                               1611 - 1620
//

Text Mined References (449)

PMID Year Title
26966027 2016 First-in-human, open-label dose-escalation and dose-expansion study of the safety, pharmacokinetics, and antitumor effects of an oral ALK inhibitor ASP3026 in patients with advanced solid tumors.
26951079 2016 Second- and third-generation ALK inhibitors for non-small cell lung cancer.
26857243 2016 Clinical utility of TERT promoter mutations and ALK rearrangement in thyroid cancer patients with a high prevalence of the BRAF V600E mutation.
26825369 2016 Improving Selection Criteria for ALK Inhibitor Therapy in Non-Small Cell Lung Cancer: A Pooled-Data Analysis on Diagnostic Operating Characteristics of Immunohistochemistry.
26823889 2015 Epithelioid inflammatory myofibroblastic sarcoma treated with ALK inhibitor: a case report and review of literature.
26755435 2016 Molecular mechanisms that underpin EML4-ALK driven cancers and their response to targeted drugs.
26719536 2016 Non-Small Cell Lung Cancer Cells Acquire Resistance to the ALK Inhibitor Alectinib by Activating Alternative Receptor Tyrosine Kinases.
26687816 2016 Mutation-Independent Activation of the Anaplastic Lymphoma Kinase in Neuroblastoma.
26630010 2015 Augmentor ? and ? (FAM150) are ligands of the receptor tyrosine kinases ALK and LTK: Hierarchy and specificity of ligand-receptor interactions.
26618223 2016 An update of ALK inhibitors in human clinical trials.
More...