Property Summary

Ligand Count 527
NCBI Gene PubMed Count 527
PubMed Score 2942.87
PubTator Score 1838.90

Knowledge Summary

Patent (521,333)

TINX Plot

  Disease (9)

Disease Target Count
non-small cell lung cancer 2890
Disease Target Count P-value
Breast cancer 3578 4.0e-20
pituitary cancer 1972 1.1e-07
osteosarcoma 7950 2.2e-06
ovarian cancer 8520 6.5e-04
non primary Sjogren syndrome sicca 891 2.3e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.4
Kidney cancer 2613 0.0 1.0
Melanoma 711 0.0 0.6
Skin cancer 469 0.0 0.7
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 7.19324966142735E-4
Disease Target Count Z-score Confidence
Cancer 2499 6.704 3.4

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer -2.000 7.2e-04
Breast cancer -1.200 4.0e-20
non primary Sjogren syndrome sicca -1.300 2.3e-02
osteosarcoma 1.161 2.2e-06
ovarian cancer -1.100 6.5e-04
pituitary cancer -1.900 1.1e-07

Gene RIF (505)

AA Sequence

MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVVPSLFRVYARD      1 - 70
LLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSVRKLRRAKQ     71 - 140
LVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRA    141 - 210
SQPRLLFQIFGTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPL    211 - 280
HDLRNQSWSWRRIPSEEASQMDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVS    281 - 350
VHRHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF    351 - 420
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFEDGFCGWT    421 - 490
QGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFPAPIKSSPCELRMSWLIRGVL    491 - 560
RGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWGQGSRAIVAFDNISI    561 - 630
SLDCYLTISGEDKILQNTAPKSRNLFERNPNKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQ    631 - 700
CNNAYQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDM    701 - 770
LYILVGQQGEDACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII    771 - 840
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGATGGHSCPQAM    841 - 910
KKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTPALKVMEGHGEVN    911 - 980
IKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVL    981 - 1050
AFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIR   1051 - 1120
GLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSL   1121 - 1190
PRFILLELMAGGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP   1191 - 1260
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPY   1261 - 1330
PSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPIE   1331 - 1400
YGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAAPPPLPTTSSGKAAKKPTAAEISVRVPRGPA   1401 - 1470
VEGGHVNMAFSQSNPPSELHKVHGSRNKPTSLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCT   1471 - 1540
VPPNVATGRLPGASLLLEPSSLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILK   1541 - 1610
SKNSMNQPGP                                                               1611 - 1620
//

Text Mined References (533)

PMID Year Title