Property Summary

NCBI Gene PubMed Count 89
Grant Count 31
R01 Count 27
Funding $4,132,630.67
PubMed Score 49.92
PubTator Score 171.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
tuberculosis -1.200 0.016
intraductal papillary-mucinous adenoma (... 1.200 0.003
intraductal papillary-mucinous carcinoma... 1.500 0.004
lung cancer -1.100 0.001
fibroadenoma 1.100 0.032
Breast cancer 3.000 0.043
interstitial cystitis -1.600 0.000
sonic hedgehog group medulloblastoma -1.400 0.003
lung adenocarcinoma 1.610 0.000
spina bifida -2.817 0.036
Pick disease -1.100 0.000
progressive supranuclear palsy -1.400 0.007
gastric carcinoma 1.200 0.011
ductal carcinoma in situ 1.900 0.001
invasive ductal carcinoma 1.800 0.001
ovarian cancer 1.700 0.000
Down syndrome 1.300 0.001

 GWAS Trait (1)

Gene RIF (52)

PMID Text
27018747 Interaction of myosin VI and its binding partner DOCK7 plays an important role in NGF-stimulated protrusion formation in PC12 cells.
26950368 This study identified an isoform-specific regulatory helix, named the alpha2-linker, that defines specific conformations and hence determines the target selectivity of human myosin VI.
26451915 we demonstrate that myosin VI and TAX1BP1 are recruited to ubiquitylated Salmonella and play a key role in xenophagy
26407123 Knockdown of MYO6 markedly reduced cell viability and colony formation, as well as suppressed cell cycle progression in breast cancer cells.
26324058 Knockdown of myosin VI significantly suppressed melanoma cell viability and proliferation.
26263762 Several postulated mechanisms of function for actin cytoskeleton and MVI during subsequent steps of clathrin-dependent endocytosis are discussed in this review.
25999546 Four mutations of MYO6 protein were found in seven Japanese families exhibiting autosomal dominant inheritance of hearing loss.
25859013 Optineurin binding to myosin VI was also decreased in tissue lysates from sporadic amyotrophic lateral sclerosis spinal cords.
25703929 MYO6 was highly expressed in hepatocellular carcinoma.
25643992 MYO6 is crucial in maintaining cell cycle and cell growth of lung cancer cells.MYO6 is highly expressed in human lung cancer tissues.
More...

AA Sequence

MEDGKPVWAPHPTDGFQMGNIVDIGPDSLTIEPLNQKGKTFLALINQVFPAEEDSKKDVEDNCSLMYLNE      1 - 70
ATLLHNIKVRYSKDRIYTYVANILIAVNPYFDIPKIYSSEAIKSYQGKSLGTRPPHVFAIADKAFRDMKV     71 - 140
LKMSQSIIVSGESGAGKTENTKFVLRYLTESYGTGQDIDDRIVEANPLLEAFGNAKTVRNNNSSRFGKFV    141 - 210
EIHFNEKSSVVGGFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIREKLHLSSPDNFRYLNRGCTR    211 - 280
YFANKETDKQILQNRKSPEYLKAGSMKDPLLDDHGDFIRMCTAMKKIGLDDEEKLDLFRVVAGVLHLGNI    281 - 350
DFEEAGSTSGGCNLKNKSAQSLEYCAELLGLDQDDLRVSLTTRVMLTTAGGTKGTVIKVPLKVEQANNAR    351 - 420
DALAKTVYSHLFDHVVNRVNQCFPFETSSYFIGVLDIAGFEYFEHNSFEQFCINYCNEKLQQFFNERILK    421 - 490
EEQELYQKEGLGVNEVHYVDNQDCIDLIEAKLVGILDILDEENRLPQPSDQHFTSAVHQKHKDHFRLTIP    491 - 560
RKSKLAVHRNIRDDEGFIIRHFAGAVCYETTQFVEKNNDALHMSLESLICESRDKFIRELFESSTNNNKD    561 - 630
TKQKAGKLSFISVGNKFKTQLNLLLDKLRSTGASFIRCIKPNLKMTSHHFEGAQILSQLQCSGMVSVLDL    631 - 700
MQGGYPSRASFHELYNMYKKYMPDKLARLDPRLFCKALFKALGLNENDYKFGLTKVFFRPGKFAEFDQIM    701 - 770
KSDPDHLAELVKRVNHWLTCSRWKKVQWCSLSVIKLKNKIKYRAEACIKMQKTIRMWLCKRRHKPRIDGL    771 - 840
VKVGTLKKRLDKFNEVVSVLKDGKPEMNKQIKNLEISIDTLMAKIKSTMMTQEQIQKEYDALVKSSEELL    841 - 910
SALQKKKQQEEEAERLRRIQEEMEKERKRREEDEKRRRKEEEERRMKLEMEAKRKQEEEERKKREDDEKR    911 - 980
IQAEVEAQLARQKEEESQQQAVLEQERRDRELALRIAQSEAELISDEAQADLALRRSLDSYPVSKNDGTR    981 - 1050
PKMTPEQMAKEMSEFLSRGPAVLATKAAAGTKKYDLSKWKYAELRDTINTSCDIELLAACREEFHRRLKV   1051 - 1120
YHAWKSKNKKRNTETEQRAPKSVTDYDFAPFLNNSPQQNPAAQIPARQREIEMNRQQRFFRIPFIRPADQ   1121 - 1190
YKDPQSKKKGWWYAHFDGPWIARQMELHPDKPPILLVAGKDDMEMCELNLEETGLTRKRGAEILPRQFEE   1191 - 1260
IWERCGGIQYLQNAIESRQARPTYATAMLQSLLK                                       1261 - 1294
//

Text Mined References (94)

PMID Year Title
27018747 2016 Interaction of myosin VI and its binding partner DOCK7 plays an important role in NGF-stimulated protrusion formation in PC12 cells.
26950368 2016 Diverse functions of myosin VI elucidated by an isoform-specific ?-helix domain.
26451915 2015 The Autophagy Receptor TAX1BP1 and the Molecular Motor Myosin VI Are Required for Clearance of Salmonella Typhimurium by Autophagy.
26407123 2015 Lentivirus-Mediated Knockdown of Myosin VI Inhibits Cell Proliferation of Breast Cancer Cell.
26324058 2015 Knockdown of myosin VI by lentivirus-mediated short hairpin RNA suppresses proliferation of melanoma.
26263762 2014 [The role of actin cytoskeleton and myosin VI in clathrin-dependent endocytosis].
25999546 2015 Massively parallel DNA sequencing successfully identified seven families with deafness-associated MYO6 mutations: the mutational spectrum and clinical characteristics.
25859013 2015 Defects in optineurin- and myosin VI-mediated cellular trafficking in amyotrophic lateral sclerosis.
25703929 2015 Knockdown of Myosin VI Inhibits Proliferation of Hepatocellular Carcinoma Cells In Vitro.
25643992 2015 Lentivirus-Mediated Silencing of Myosin VI Inhibits Proliferation and Cell Cycle Progression in Human Lung Cancer Cells.
More...