Property Summary

NCBI Gene PubMed Count 18
PubMed Score 16.09
PubTator Score 12.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
astrocytic glioma -1.300 2.9e-02
atypical teratoid / rhabdoid tumor -1.800 8.9e-05
Breast cancer -1.100 3.7e-03
breast carcinoma -1.200 4.3e-03
cystic fibrosis -4.318 1.6e-08
ductal carcinoma in situ -1.500 3.8e-03
ependymoma -1.500 3.5e-02
fibroadenoma -1.600 3.3e-02
gastric carcinoma 1.300 2.8e-02
group 3 medulloblastoma -3.100 1.1e-05
head and neck cancer -2.000 2.0e-04
invasive ductal carcinoma 1.064 1.3e-03
medulloblastoma, large-cell -2.500 1.4e-04
non-small cell lung cancer -1.182 6.3e-07
oligodendroglioma -1.100 7.8e-10
ovarian cancer 1.300 2.2e-02
pancreatic cancer 1.500 1.2e-03
Pick disease -1.600 3.1e-03
pituitary cancer 1.800 1.3e-06
primary pancreatic ductal adenocarcinoma 1.965 2.8e-04
primitive neuroectodermal tumor -1.800 1.4e-04
psoriasis -1.100 1.2e-06

Synonym

Accession Q9UM22 A8K4C0 C9JYS3 Q06BL0 Q99M77 MERP-1
Symbols EPDR
UCC1
MERP1
MERP-1

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Gene RIF (6)

AA Sequence

MPGRAPLRTVPGALGAWLLGGLWAWTLCGLCSLGAVGAPRPCQAPQQWEGRQVMYQQSSGRNSRALLSYD      1 - 70
GLNQRVRVLDERKALIPCKRLFEYILLYKDGVMFQIDQATKQCSKMTLTQPWDPLDIPQNSTFEDQYSIG     71 - 140
GPQEQITVQEWSDRKSARSYETWIGIYTVKDCYPVQETFTINYSVILSTRFFDIQLGIKDPSVFTPPSTC    141 - 210
QMAQLEKMSEDCSW                                                            211 - 224
//

Text Mined References (23)

PMID Year Title