Property Summary

NCBI Gene PubMed Count 14
Grant Count 6
R01 Count 6
Funding $649,786
PubMed Score 14.33
PubTator Score 13.70

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

Gene RIF (21)

PMID Text
26589799 Data suggest microRNA-424 regulates expression of MGAT4A (mannoside beta-1,4-N-acetylglucosaminyltransferase A), OGT (O-linked N-acetylglucosamine transferase), and GALNT13 (polypeptide N-acetylgalactosaminyltransferase 13) in mammary epithelium.
23169300 Findings suggest that GnT-IVa is involved in regulating invasion of choriocarcinoma through modifications of the oligosaccharide chains of beta1 integrin.
19751437 GNT-IV genetic variation is not associated with gastric cancer.
17953760 The results of this work suggest that in T2D subjects, high levels of glucose and triglycerides are accompanied by an increase on MGAT4A mRNA levels and WBC count; condition that suggests a pro-inflammatory state due to a chronic metabolic stress.
17488527 We investigated mRNA levels of glycosyltransferases, namely, N-acetylglucosaminyltransferase a (GnT)-IVa, and found that (GnT)-IVa expression was decreased in HLE-cells Epirubicin resistant.
17006639 GnT-IVa is more active than GnT-IVb under physiological conditions and it primarily contributes to the biosynthesis of N-glycans.
16434023 analysis of expression of N-acetylglucosaminyltransferase-IVa and IVb (GnT-IVa and b) in pancreatic cancer
15688387 upregulation of mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetyl-glucosaminyl-transferase is associated with metastatic colorectal carcinoma
11530211 Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions
9109416 Mannose-containing, N-linked oligosaccharide side-chains of HIV-1 gp41 are involved in the initial stage of infection by HIV-1; glycosylation inhibitors block virus-cell and cell-cell fusion and release of the virions
More...

AA Sequence

MRLRNGTVATALAFITSFLTLSWYTTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFK      1 - 70
RVGAETNGSKDALNKFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMG     71 - 140
IPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISP    141 - 210
PESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQL    211 - 280
SSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANL    281 - 350
RIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWA    351 - 420
ITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIG    421 - 490
KFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN                             491 - 535
//

Text Mined References (18)

PMID Year Title
26589799 2016 MicroRNA-424 Predicts a Role for ?-1,4 Branched Glycosylation in Cell Cycle Progression.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
23169300 2012 High expression of N-acetylglucosaminyltransferase IVa promotes invasion of choriocarcinoma.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21738484 2011 Genome-wide association of bipolar disorder suggests an enrichment of replicable associations in regions near genes.
19751437 2009 Genetic variation in a4GnT in relation to Helicobacter pylori serology and gastric cancer risk.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
17953760 2007 The transcription of MGAT4A glycosyl transferase is increased in white cells of peripheral blood of type 2 diabetes patients.
17488527 2007 N-glycan alterations are associated with drug resistance in human hepatocellular carcinoma.
17006639 2006 Kinetic properties and substrate specificities of two recombinant human N-acetylglucosaminyltransferase-IV isozymes.
More...