Property Summary

NCBI Gene PubMed Count 14
PubMed Score 15.76
PubTator Score 13.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
adult high grade glioma -1.200 3.3e-03
atypical teratoid / rhabdoid tumor -2.800 2.9e-08
Breast cancer -1.600 3.7e-21
breast carcinoma 1.100 6.1e-21
cutaneous lupus erythematosus 1.500 1.5e-02
ductal carcinoma in situ 2.300 3.3e-03
ependymoma -1.200 3.3e-02
glioblastoma 1.200 9.3e-03
group 3 medulloblastoma -2.000 1.6e-03
hepatocellular carcinoma -1.300 1.9e-02
intraductal papillary-mucinous adenoma (... -1.800 6.4e-04
intraductal papillary-mucinous carcinoma... -1.600 2.5e-03
intraductal papillary-mucinous neoplasm ... -1.700 1.2e-02
invasive ductal carcinoma 1.223 2.5e-03
lung cancer -2.600 6.5e-04
lung carcinoma 1.300 3.5e-21
medulloblastoma, large-cell -3.000 2.7e-06
non-small cell lung cancer -1.107 3.6e-09
oligodendroglioma -1.300 2.6e-02
osteosarcoma -2.584 2.4e-07
ovarian cancer 1.700 9.7e-05
primitive neuroectodermal tumor -1.300 2.2e-02
pulmonary arterial hypertension 1.400 2.5e-02
tuberculosis 1.100 6.3e-04
ulcerative colitis -1.500 1.3e-06

Gene RIF (20)

AA Sequence

MRLRNGTVATALAFITSFLTLSWYTTWQNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFK      1 - 70
RVGAETNGSKDALNKFSDNTLKLLKELTSKKSLQVPSIYYHLPHLLKNEGSLQPAVQIGNGRTGVSIVMG     71 - 140
IPTVKREVKSYLIETLHSLIDNLYPEEKLDCVIVVFIGETDIDYVHGVVANLEKEFSKEISSGLVEVISP    141 - 210
PESYYPDLTNLKETFGDSKERVRWRTKQNLDYCFLMMYAQEKGIYYIQLEDDIIVKQNYFNTIKNFALQL    211 - 280
SSEEWMILEFSQLGFIGKMFQAPDLTLIVEFIFMFYKEKPIDWLLDHILWVKVCNPEKDAKHCDRQKANL    281 - 350
RIRFRPSLFQHVGLHSSLSGKIQKLTDKDYMKPLLLKIHVNPPAEVSTSLKVYQGHTLEKTYMGEDFFWA    351 - 420
ITPIAGDYILFKFDKPVNVESYLFHSGNQEHPGDILLNTTVEVLPFKSEGLEISKETKDKRLEDGYFRIG    421 - 490
KFENGVAEGMVDPSLNPISAFRLSVIQNSAVWAILNEIHIKKATN                             491 - 535
//

Text Mined References (18)

PMID Year Title