Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.40
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -3.600 0.013
posterior fossa group A ependymoma -4.000 0.000
oligodendroglioma -2.700 0.000
glioblastoma -4.600 0.000
medulloblastoma -5.500 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -5.300 0.000
primitive neuroectodermal tumor -3.700 0.001
adult high grade glioma -4.400 0.000
pilocytic astrocytoma -4.000 0.000
subependymal giant cell astrocytoma -4.799 0.005
Pick disease -1.400 0.014
pituitary cancer 1.700 0.004

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM     71 - 140
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK                       141 - 191
//

Text Mined References (16)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...