Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.54
PubTator Score 1.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -4.400 3.8e-08
astrocytic glioma -2.900 4.4e-03
Astrocytoma, Pilocytic -4.000 2.0e-11
atypical teratoid / rhabdoid tumor -4.400 1.5e-07
ependymoma -3.400 3.9e-03
glioblastoma -3.800 2.8e-10
group 3 medulloblastoma -4.500 1.2e-05
medulloblastoma, large-cell -5.300 6.7e-09
oligodendroglioma -1.700 2.2e-02
Pick disease -1.400 1.4e-02
pituitary cancer 1.700 3.9e-03
primitive neuroectodermal tumor -3.700 1.2e-03
subependymal giant cell astrocytoma -4.799 4.6e-03

Synonym

Accession Q9UM19 B2R5U2 D3DPU1 Q5TG97 Q8N611 HLP4
Symbols HLP4

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (1)

AA Sequence

MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM     71 - 140
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK                       141 - 191
//

Text Mined References (16)

PMID Year Title