Property Summary

NCBI Gene PubMed Count 15
PubMed Score 3.40
PubTator Score 1.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
oligodendroglioma 2849 2.60390657105986E-18
posterior fossa group A ependymoma 1511 4.20344383071191E-14
medulloblastoma 1524 7.20674797498505E-12
pilocytic astrocytoma 3086 2.45466954141973E-11
medulloblastoma, large-cell 6234 6.73890369733923E-9
adult high grade glioma 2148 3.84811976266838E-8
atypical teratoid / rhabdoid tumor 4369 1.48474836076937E-7
glioblastoma 5572 3.01770017800389E-6
primitive neuroectodermal tumor 3031 0.0011670922388147
pituitary cancer 1972 0.00385288667839263
subependymal giant cell astrocytoma 2287 0.00460180601653558
astrocytoma 1493 0.0129944616837343
Pick disease 1893 0.0139880329305432

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytoma -3.600 0.013
posterior fossa group A ependymoma -4.000 0.000
oligodendroglioma -2.700 0.000
glioblastoma -4.600 0.000
medulloblastoma -5.500 0.000
atypical teratoid / rhabdoid tumor -4.400 0.000
medulloblastoma, large-cell -5.300 0.000
primitive neuroectodermal tumor -3.700 0.001
adult high grade glioma -4.400 0.000
pilocytic astrocytoma -4.000 0.000
subependymal giant cell astrocytoma -4.799 0.005
Pick disease -1.400 0.014
pituitary cancer 1.700 0.004

Synonym

Accession Q9UM19 B2R5U2 D3DPU1 Q5TG97 Q8N611 HLP4
Symbols HLP4

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGDASKFAQHAFR      1 - 70
TFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLEMLEIIEAIYKMVGTVIMMRM     71 - 140
NQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPSIVLLLQCDMQK                       141 - 191
//

Text Mined References (16)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...