Property Summary

NCBI Gene PubMed Count 26
Grant Count 7
R01 Count 5
Funding $249,700.64
PubMed Score 18.06
PubTator Score 13.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis -1.100 0.003
medulloblastoma, large-cell -1.400 0.000
ovarian cancer 1.200 0.000

 GWAS Trait (1)

Gene RIF (2)

PMID Text
21336306 Cdc20 requires APC3 and APC8 to bind and activate the APC/C when the spindle assembly checkpoint is satisfied, but only APC8 when active, and APC10 is crucial for the destruction of cyclin B1 and securin, but not cyclin A
21186364 Substrates are recruited to the Anaphase-promoting complex by binding to a bipartite substrate receptor composed of Cdh1 and Doc1.

AA Sequence

MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRR      1 - 70
KTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIA     71 - 140
VLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR                             141 - 185
//

Text Mined References (29)

PMID Year Title
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25043029 2014 Molecular architecture and mechanism of the anaphase-promoting complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21926987 2011 APC15 drives the turnover of MCC-CDC20 to make the spindle assembly checkpoint responsive to kinetochore attachment.
21336306 2011 How APC/C-Cdc20 changes its substrate specificity in mitosis.
21186364 2011 Substrate binding on the APC/C occurs between the coactivator Cdh1 and the processivity factor Doc1.
18485873 2008 Mechanism of ubiquitin-chain formation by the human anaphase-promoting complex.
16364912 2005 Localization of the coactivator Cdh1 and the cullin subunit Apc2 in a cryo-electron microscopy model of vertebrate APC/C.
15489335 2004 Human ORFeome version 1.1: a platform for reverse proteomics.
More...