Property Summary

NCBI Gene PubMed Count 118
Grant Count 75
R01 Count 46
Funding $12,172,527.92
PubMed Score 281.82
PubTator Score 263.96

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -5.868 0.000
tuberculosis 2.100 0.000
psoriasis -2.000 0.000

Synonym

Accession Q9UM07 A8K392 B2RBW0 Q5VTZ8 Q70SX4
Symbols PAD
PAD4
PDI4
PDI5
PADI5

Gene

PANTHER Protein Class (1)

PDB

1WD8   1WD9   1WDA   2DEW   2DEX   2DEY   2DW5   3APM   3APN   3B1T   3B1U   4DKT   4X8C   4X8G  

MLP Assay (16)

AID Type Active / Inconclusive / Inactive Description
463073 screening 10 / 0 / 1990 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of Protein Arginine Deiminase 4 (PAD4)
463083 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4)
485272 screening 1334 / 0 / 324800 Fluorescence polarization-based primary biochemical high throughput screening assay to identify inhibitors of Protein Arginine Deiminase 4 (PAD4) (1536 HTS)
488796 screening 330 / 0 / 852 Fluorescence polarization-based biochemical high throughput confirmation assay for inhibitors of Protein Arginine Deiminase 4 (PAD4)
492970 confirmatory 1 / 0 / 9 Fluorescence-based biochemical dose response assay to identify inhibitors of Protein Arginine Deiminase 4 (PAD4)
588416 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 16 against PAD4
588417 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 15 against PAD4
588418 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 13 against PAD4
588419 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 12 against PAD4
588420 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 11 against PAD4
More...

Gene RIF (122)

PMID Text
26546893 PADI4 rs1748033 gene polymorphism increased the risk of RA in a sample of the Iranian population.
26255191 We identified the presence of PADI3 mRNA expression in synovial tissue and PADI2 and PADI4 mRNA expressions in fibroblast-like synoviocytes from patients with rheumatoid arthritis.
26245941 PAD4 activity was significantly higher in cell-free synovial fluid of rheumatoid arthritis patients compared to osteoarthritis patients.
26149185 Data show that peptidylarginine deiminase type 4, mutated citrullinated vimentin and cyclic citrullinated peptides autoantibodies were detected in 24, 61 and 74% of rheumatoid arthritis (RA) patients, respectively.
26082376 Silencing of PADI4 attenuates the TNF-alpha-induced osteogenic differentiation of human mesenchymal stem cells.
26043831 PADI4-94G/A polymorphism is associated with susceptibility to rheumatoid arthritis in the overall population and in the Asian population.
26019128 PAD-4 is inhibited by PTPN22.
25562673 Data show that peptidyl arginine deiminase type IV (PADI4) polymorphisms and a functional haplotype are associated with rheumatoid arthritis.
25205591 We found that heterozygote genotypes for PADI4_89 were protectively associated with susceptibility to tuberculosis.
25138370 genetic variants in CDK6 and PADI4 were associated with anti-citrullinated cyclic peptide status in rheumatoid arthritis DRB1*04 negative patients
More...

AA Sequence

MAQGTLIRVTPEQPTHAVCVLGTLTQLDICSSAPEDCTSFSINASPGVVVDIAHGPPAKKKSTGSSTWPL      1 - 70
DPGVEVTLTMKVASGSTGDQKVQISYYGPKTPPVKALLYLTGVEISLCADITRTGKVKPTRAVKDQRTWT     71 - 140
WGPCGQGAILLVNCDRDNLESSAMDCEDDEVLDSEDLQDMSLMTLSTKTPKDFFTNHTLVLHVARSEMDK    141 - 210
VRVFQATRGKLSSKCSVVLGPKWPSHYLMVPGGKHNMDFYVEALAFPDTDFPGLITLTISLLDTSNLELP    211 - 280
EAVVFQDSVVFRVAPWIMTPNTQPPQEVYACSIFENEDFLKSVTTLAMKAKCKLTICPEEENMDDQWMQD    281 - 350
EMEIGYIQAPHKTLPVVFDSPRNRGLKEFPIKRVMGPDFGYVTRGPQTGGISGLDSFGNLEVSPPVTVRG    351 - 420
KEYPLGRILFGDSCYPSNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPAPDRKGFRLL    421 - 490
LASPRSCYKLFQEQQNEGHGEALLFEGIKKKKQQKIKNILSNKTLREHNSFVERCIDWNRELLKRELGLA    491 - 560
ESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGIPKPFGPVINGRCCLEEKVCSLLEPLGLQCTFI    561 - 630
NDFFTYHIRHGEVHCGTNVRRKPFSFKWWNMVP                                         631 - 663
//

Text Mined References (124)

PMID Year Title
26546893 2015 Association between Peptidylarginine Deiminase Type 4 rs1748033 Polymorphism and Susceptibility to Rheumatoid Arthritis in Zahedan, Southeast Iran.
26255191 2016 The amount of citrullinated proteins in synovial tissue is related to serum anti-cyclic citrullinated peptide (anti-CCP) antibody levels.
26245941 2015 Release of Active Peptidyl Arginine Deiminases by Neutrophils Can Explain Production of Extracellular Citrullinated Autoantigens in Rheumatoid Arthritis Synovial Fluid.
26149185 2015 Comparative analysis of autoantibodies targeting peptidylarginine deiminase type 4, mutated citrullinated vimentin and cyclic citrullinated peptides in rheumatoid arthritis: associations with cytokine profiles, clinical and genetic features.
26082376 2015 Expression of PADI4 in patients with ankylosing spondylitis and its role in mediating the effects of TNF-? on the proliferation and osteogenic differentiation of human mesenchymal stem cells.
26043831 2015 Associations Between PADI4 Gene Polymorphisms and Rheumatoid Arthritis: An Updated Meta-analysis.
26019128 2015 The W620 Polymorphism in PTPN22 Disrupts Its Interaction With Peptidylarginine Deiminase Type 4 and Enhances Citrullination and NETosis.
25562673 2015 Polymorphisms and functional haplotype in PADI4: further evidence for contribution on rheumatoid arthritis susceptibility and anti-cyclic citrullinated peptide antibodies in a western Mexican population.
25416956 2014 A proteome-scale map of the human interactome network.
25205591 2015 Heterozygote genotypes for PADI4_89 were protectively associated with susceptibility to tuberculosis in Koreans.
More...