Property Summary

NCBI Gene PubMed Count 31
PubMed Score 56.00
PubTator Score 61.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Cystinuria 18 4.111 2.1
Urea cycle disorder 7 3.1 1.5

Expression

  Differential Expression (21)

Disease log2 FC p
active ulcerative colitis 1.881 4.4e-02
Astrocytoma, Pilocytic 1.100 4.9e-05
cutaneous lupus erythematosus 1.800 3.2e-03
cystic fibrosis -1.100 2.0e-04
gastric carcinoma 1.500 1.9e-02
glioblastoma 1.800 1.0e-03
head and neck cancer and chronic obstruc... 1.200 5.7e-04
interstitial cystitis 1.900 4.1e-04
intraductal papillary-mucinous neoplasm ... 1.900 4.7e-03
lung adenocarcinoma -1.203 1.0e-06
lung cancer -1.600 2.1e-02
lung carcinoma -2.900 3.6e-27
mucosa-associated lymphoid tissue lympho... 2.611 1.8e-02
nephrosclerosis -1.739 5.0e-03
non-small cell lung cancer -1.692 7.6e-16
osteosarcoma -1.139 4.3e-02
ovarian cancer -2.400 8.0e-10
pediatric high grade glioma 1.100 4.4e-03
primary Sjogren syndrome 1.300 3.1e-03
subependymal giant cell astrocytoma 1.972 2.7e-03
tuberculosis 1.300 3.2e-08

Protein-protein Interaction (1)

Gene RIF (15)

AA Sequence

MVDSTEYEVASQPEVETSPLGDGASPGPEQVKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLIYSASFG      1 - 70
LSLVIWAVGGLFSVFGALCYAELGTTIKKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAIIAITFA     71 - 140
NYMVQPLFPSCFAPYAASRLLAAACICLLTFINCAYVKWGTLVQDIFTYAKVLALIAVIVAGIVRLGQGA    141 - 210
STHFENSFEGSSFAVGDIALALYSALFSYSGWDTLNYVTEEIKNPERNLPLSIGISMPIVTIIYILTNVA    211 - 280
YYTVLDMRDILASDAVAVTFADQIFGIFNWIIPLSVALSCFGGLNASIVAASRLFFVGSREGHLPDAICM    281 - 350
IHVERFTPVPSLLFNGIMALIYLCVEDIFQLINYYSFSYWFFVGLSIVGQLYLRWKEPDRPRPLKLSVFF    351 - 420
PIVFCLCTIFLVAVPLYSDTINSLIGIAIALSGLPFYFLIIRVPEHKRPLYLRRIVGSATRYLQVLCMSV    421 - 490
AAEMDLEDGGEMPKQRDPKSN                                                     491 - 511
//

Text Mined References (39)

PMID Year Title