Property Summary

NCBI Gene PubMed Count 25
PubMed Score 12.84
PubTator Score 11.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Glaucoma 239 4.754 2.4
Disease Target Count Z-score Confidence
Gingival fibromatosis 14 3.27 1.6
Blindness 88 3.193 1.6
Disease Target Count
Cerebro-facio-thoracic dysplasia 1

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.100 5.4e-10
glioblastoma 1.100 2.2e-06
group 3 medulloblastoma 1.300 2.0e-03
intraductal papillary-mucinous adenoma (... 1.100 3.4e-03
intraductal papillary-mucinous neoplasm ... 1.100 6.2e-03
invasive ductal carcinoma 1.100 1.9e-03
lung adenocarcinoma 1.045 3.1e-09
lung cancer 1.700 1.6e-04
Multiple myeloma 1.682 3.1e-03
osteosarcoma 2.216 9.0e-06
ovarian cancer -1.400 7.3e-03

 GO Function (1)

Gene RIF (9)

AA Sequence

MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKLEKKKETITESAGRQQKKKIE      1 - 70
RQEEKLKNNNRDLSMVRMKSMFAIGFCFTALMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTD     71 - 140
CSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS                          141 - 188
//

Text Mined References (31)

PMID Year Title