Property Summary

NCBI Gene PubMed Count 28
Grant Count 6
R01 Count 6
Funding $849,075.17
PubMed Score 25.18
PubTator Score 26.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Migraine 79 1.0
Migraine Disorders 26

Expression

Synonym

Accession Q9ULZ9 Q14850 MMP-17
Symbols MMP-17
MT4MMP
MTMMP4
MT4-MMP

Gene

Gene RIF (15)

PMID Text
26663028 The MT4-MMP is internalized by the clathrin-independent carriers/GPI-enriched early endosomal compartments pathway, a mechanism that differs from that responsible for the internalization of other membrane-type MMP members.
25963716 Screening of patients with inherited thoracic aortic aneurysms and dissections identified a missense mutation (R373H) in the MMP17 gene that prevented the expression of the protease in human transfected cells.
25320013 A functional link between MT4-MMP and the growth factor receptor EGFR.
22674854 CAV1 when found in lipid rafts does not allow the metalloproteinase MT4-MMP to localize into the lipid rafts, affecting its expression in the cell and probably its activity which is translated into the metastasis-associated activities of these cells.
22262494 It identifies MT4-MMP as a key intrinsic tumor cell determinant that contributes to the elaboration of a permissive microenvironment for metastatic dissemination.
21828052 The data presented here provide a new insight into the characteristics of MT4-MMP and highlight the common and distinct properties of the glycosylphosphatidylinositol-anchored membrane type-matrix metalloproteinases.
20673868 Observational study of gene-disease association. (HuGE Navigator)
20587546 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20019845 Studies suggest a model of hypoxia induced metastasis through expression of HIF-1alpha, and SLUG regulation of MT4-MMP transcription.
More...

AA Sequence

MRRRAARGPGPPPPGPGLSRLPLPLLLLLALGTRGGCAAPAPAPRAEDLSLGVEWLSRFGYLPPADPTTG      1 - 70
QLQTQEELSKAITAMQQFGGLEATGILDEATLALMKTPRCSLPDLPVLTQARRRRQAPAPTKWNKRNLSW     71 - 140
RVRTFPRDSPLGHDTVRALMYYALKVWSDIAPLNFHEVAGSAADIQIDFSKADHNDGYPFDGPGGTVAHA    141 - 210
FFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRY    211 - 280
GLPYEDKVRVWQLYGVRESVSPTAQPEEPPLLPEPPDNRSSAPPRKDVPHRCSTHFDAVAQIRGEAFFFK    281 - 350
GKYFWRLTRDRHLVSLQPAQMHRFWRGLPLHLDSVDAVYERTSDHKIVFFKGDRYWVFKDNNVEEGYPRP    351 - 420
VSDFSLPPGGIDAAFSWAHNDRTYFFKDQLYWRYDDHTRHMDPGYPAQSPLWRGVPSTLDDAMRWSDGAS    421 - 490
YFFRGQEYWKVLDGELEVAPGYPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEV    491 - 560
CSCTSGASSPPGAPGPLVAATMLLLLPPLSPGALWTAAQALTL                               561 - 603
//

Text Mined References (29)

PMID Year Title
26663028 2016 Dynamics of internalization and recycling of the prometastatic membrane type 4 matrix metalloproteinase (MT4-MMP) in breast cancer cells.
25963716 2015 Deficiency of MMP17/MT4-MMP proteolytic activity predisposes to aortic aneurysm in mice.
25320013 2014 EGFR activation and signaling in cancer cells are enhanced by the membrane-bound metalloprotease MT4-MMP.
22683712 2012 Genome-wide association analysis identifies susceptibility loci for migraine without aura.
22674854 2013 Restoration of caveolin-1 expression suppresses growth, membrane-type-4 metalloproteinase expression and metastasis-associated activities in colon cancer cells.
22262494 2012 The proteolytic activity of MT4-MMP is required for its pro-angiogenic and pro-metastatic promoting effects.
21828052 2011 Characterization of the dimerization interface of membrane type 4 (MT4)-matrix metalloproteinase.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
More...