Property Summary

NCBI Gene PubMed Count 114
Grant Count 183
R01 Count 128
Funding $33,094,165.14
PubMed Score 50.49
PubTator Score 657.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
nephrosclerosis 1.323 0.000
Waldenstrons macroglobulinemia 1.075 0.030
malignant mesothelioma -2.800 0.000
psoriasis 2.300 0.000
osteosarcoma -1.635 0.005
glioblastoma 2.000 0.001
tuberculosis 2.800 0.000
primary pancreatic ductal adenocarcinoma 1.059 0.024
intraductal papillary-mucinous carcinoma... 1.100 0.012
lung cancer -1.300 0.000
pancreatic cancer 1.100 0.000
pediatric high grade glioma 1.200 0.013
pilocytic astrocytoma 1.500 0.000
subependymal giant cell astrocytoma 1.762 0.011
invasive ductal carcinoma 1.113 0.003
lung carcinoma -1.700 0.000
Breast cancer 1.100 0.003
ductal carcinoma in situ 1.200 0.019
ovarian cancer 2.300 0.000

Synonym

Accession Q9ULZ3 Q96D12 Q9BSZ5 Q9HBD0 Q9NXJ8 hASC
Symbols ASC
TMS
TMS1
CARD5
TMS-1

Gene

PDB

1UCP   2KN6   3J63   5H8O  

 GWAS Trait (1)

Gene RIF (87)

PMID Text
26468282 ASC Induces Procaspase-8 Death Effector Domain Filaments
26457439 The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media.
26093088 ASC/TMS1 methylation was significantly correlated with higher tumor nuclear grade. ASC/TMS1 is a novel functional tumor suppressor in renal carcinogenesis.
25567507 ASC interacts with NALP3 and caspase-1 via different domains.
25372293 caspase-1/ASC inflammasomes play a significant role in the activation of IL-1beta/ROS and NF-kappaB signaling of cytokine gene expression for T. cruzi control in human and mouse macrophages.
25205754 Neutralization of ASC improves sperm motility in men with spinal cord injuries.
25191796 The proteins (HSP90b, TSM1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases.
25061439 mRNA levels of Apoptosis-associated Speck-like protein were significantly higher in freshly isolated PBMCs from Chronic recurrent multifocal osteomyelitis patients in active disease than in healthy controls.
25011057 Transcriptome analysis of human adipocytes implicates the NOD-like receptor pathway (NLRP3, PYCARD) in obesity-induced adipose inflammation.
25006247 R42W mutation had a significant effect on structure and increased stability. Although the R42W mutant exhibited reduced interaction with ASC
More...

AA Sequence

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA      1 - 70
NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV     71 - 140
LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS                   141 - 195
//

Text Mined References (125)

PMID Year Title
26468282 2015 The Inflammasome Adaptor ASC Induces Procaspase-8 Death Effector Domain Filaments.
26457439 2016 Activation of NLRP3 inflammasome in human middle ear cholesteatoma and chronic otitis media.
26093088 2015 Epigenetic inactivation of the candidate tumor suppressor gene ASC/TMS1 in human renal cell carcinoma and its role as a potential therapeutic target.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25567507 2015 Purification and analysis of the interactions of caspase-1 and ASC for assembly of the inflammasome.
25416956 2014 A proteome-scale map of the human interactome network.
25402006 2015 In silico prediction of physical protein interactions and characterization of interactome orphans.
25372293 2014 Caspase-1/ASC inflammasome-mediated activation of IL-1?-ROS-NF-?B pathway for control of Trypanosoma cruzi replication and survival is dispensable in NLRP3-/- macrophages.
25205754 2014 Neutralization of ASC improves sperm motility in men with spinal cord injury.
25191796 2014 Potential diagnostic significance of HSP90, ACS/TMS1, and L-plastin in the identification of melanoma.
More...