Property Summary

NCBI Gene PubMed Count 131
PubMed Score 55.85
PubTator Score 657.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -2.800 2.8e-07
adult high grade glioma 1.100 3.4e-02
Astrocytoma, Pilocytic 1.500 7.5e-07
Breast cancer 1.100 2.9e-03
ductal carcinoma in situ 1.200 1.9e-02
glioblastoma 2.000 6.6e-04
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
invasive ductal carcinoma 1.113 3.2e-03
lung cancer -1.300 2.5e-04
lung carcinoma -1.700 3.0e-22
nephrosclerosis 1.323 2.1e-04
osteosarcoma -1.635 4.7e-03
ovarian cancer -1.700 2.6e-05
pancreatic cancer 1.100 4.1e-04
primary pancreatic ductal adenocarcinoma 1.059 2.4e-02
psoriasis 2.300 1.9e-05
subependymal giant cell astrocytoma 1.762 1.1e-02
tuberculosis 2.800 5.2e-09
Waldenstrons macroglobulinemia 1.075 3.0e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (100)

AA Sequence

MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDALDLTDKLVSFYLETYGAELTA      1 - 70
NVLRDMGLQEMAGQLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKV     71 - 140
LTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS                   141 - 195
//

Text Mined References (144)

PMID Year Title