Property Summary

NCBI Gene PubMed Count 22
PubMed Score 3.27
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.476 0.019
cutaneous lupus erythematosus 3.500 0.000
osteosarcoma -4.380 0.000
periodontitis 1.300 0.000
medulloblastoma, large-cell 1.300 0.012
interstitial cystitis 3.000 0.004
primary Sjogren syndrome 2.700 0.000
nasopharyngeal carcinoma -1.300 0.025
ulcerative colitis 2.000 0.015
pituitary cancer 1.100 0.009

Synonym

Accession Q9ULZ2 B2R980 STAP-1
Symbols BRDG1
STAP-1

Gene

PANTHER Protein Class (2)

PDB

1X1F   3MAZ  

Gene RIF (2)

PMID Text
25035151 Mutations in STAP1 are associated with autosomal dominant hypercholesterolemia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLD      1 - 70
IVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHE     71 - 140
VLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRN    141 - 210
YSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPS    211 - 280
MEGRSEKLKKNPHIA                                                           281 - 295
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25035151 2014 Mutations in STAP1 are associated with autosomal dominant hypercholesterolemia.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20442417 2010 Loops govern SH2 domain specificity by controlling access to binding pockets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936702 2007 S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling.
More...