Property Summary

NCBI Gene PubMed Count 177
Grant Count 83
R01 Count 23
Funding $8,681,865.95
PubMed Score 561.36
PubTator Score 305.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.109 0.005
lung adenocarcinoma -1.200 0.000

Synonym

Accession Q9ULZ1 Q4VY08 Q8WU89
Symbols APEL
XNPEP2

Gene

PANTHER Protein Class (2)

Gene RIF (166)

PMID Text
26904686 The concentrations of gastric peptide(Ghrelin and obestatin)and adipocytokines(omentin and Apelin ) across all subgroups were lower than in the control group. The differences were statistically significant (p < 0.0001), which may be of importance in the development of the disease complications
26817104 The results of the study suggest that the levels of apelin, TNF-alpha and elastase-1 are important diagnostic markers of CP in patients with type 2 diabetes mellitus.
26789934 Resequencing of the apelin gene in subjects stratified by low or high apelin levels identified five APLN variants in an European population. No association was found between the most frequent variant, diabetes, and metabolic parameters.
26676468 These findings suggested that Apelin/APLNR signaling may be used as a potential therapeutic target for hypoxic/ischemic injury.
26634301 Apelin directly interferes with thrombin-mediated signaling pathways and platelet activation, secretion, and aggregation, but not with ADP and thromboxane A2-mediated pathways.
26475217 apelin is a potential indicator of the vessel normalization window during antiangiogenic therapy.
26436483 The expressions of apelin and APJ are significantly augmented by hypoxia through the hypoxia-inducible factor-1 alpha (HIF-1alpha) signaling pathway.
26394665 Data suggest expression of APLN is down-regulated in placental chorionic villi in pre-eclampsia as compared to control villi; pyroglutamate-apelin-13 is predominant form of endogenous apelin in chorionic villi of pre-eclamptic and normal pregnancies.
26342945 apelin may be have a role in left ventricular hypertrophy in hypertensive patients
26316706 Treatment with metformin and DPP4 inhibitor vildagliptin favorably changed glycemic indices and apelin levels in type 2 diabetics.
More...

AA Sequence

MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLS      1 - 70
HKGPMPF                                                                    71 - 77
//

Text Mined References (178)

PMID Year Title
26904686 2016 Assessment of Serum Concentrations of Ghrelin, Obestatin, Omentin-1, and Apelin in Children with Type 1 Diabetes.
26817104 2015 [DIAGNOSTIC MARKERS FOR CHRONIC PANCREATITIS IN PATIENTS WITH TYPE 2 DIABETES MELLITUS WITH DIFFERENT PHENOTYPE].
26789934 2016 Search for Genetic Variant in the Apelin Gene by Resequencing and Association Study in European Subjects.
26676468 2016 Hypoxia induces the proliferation of endothelial progenitor cells via upregulation of Apelin/APLNR/MAPK signaling.
26634301 2016 Apelin: an antithrombotic factor that inhibits platelet function.
26475217 2016 Apelin as a marker for monitoring the tumor vessel normalization window during antiangiogenic therapy.
26436483 2015 Apelin/APJ signaling in hypoxia-related diseases.
26394665 2015 Downregulation of apelin in the human placental chorionic villi from preeclamptic pregnancies.
26342945 2015 Serum apelin is associated with left ventricular hypertrophy in untreated hypertension patients.
26316706 2015 Treatment with metformin and a dipeptidyl peptidase-4 inhibitor elevates apelin levels in patients with type 2 diabetes mellitus.
More...