Property Summary

Ligand Count 12
NCBI Gene PubMed Count 205
PubMed Score 609.59
PubTator Score 305.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.200 7.6e-10
osteosarcoma 1.109 4.9e-03

Synonym

Accession Q9ULZ1 Q4VY08 Q8WU89
Symbols APEL
XNPEP2

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

Protein-protein Interaction (1)

Gene RIF (192)

AA Sequence

MNLRLCVQALLLLWLSLTAVCGGSLMPLPDGNGLEDGNVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLS      1 - 70
HKGPMPF                                                                    71 - 77
//

Text Mined References (206)

PMID Year Title