Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.6e-02

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 2.000 1.6e-02

AA Sequence

MRASPCISQPAASWHPRPSALRPTAGSGPDTRTPGTVEDGSAPCPAFRSPAVSPCGEEPCCFQISPAEET      1 - 70
LELGRLVSPGNCDTLSPRAAGFYACHVRSLIPCRSTKGRWPLTASAAGLSRHAQCGPSLGLG             71 - 132
//

Text Mined References (6)

PMID Year Title