Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 3
Funding $659,798.27
PubMed Score 46.75
PubTator Score 20.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.400 0.001
osteosarcoma -2.363 0.002
tuberculosis and treatment for 6 months -1.700 0.005
non-small cell lung carcinoma -1.200 0.000
interstitial cystitis 1.500 0.008
lung adenocarcinoma -3.400 0.000
pancreatic carcinoma 1.400 0.001
lung carcinoma -1.900 0.000
mucosa-associated lymphoid tissue lympho... 1.593 0.008
ulcerative colitis 1.300 0.001
psoriasis 2.100 0.000

Gene RIF (16)

PMID Text
26456705 Induction of Mincle by Helicobacter pylori and consequent anti-inflammatory signaling denote a bacterial survival strategy.
26296894 results suggest that cholesterol crystals are an endogenous ligand for hMincle and that they activate innate immune responses
26202982 Data indicate that MINCLE receptor is able to mediate the response to trehalose-6,6-dimycolate (TDM) dependent on SYK kinase and CARD9 protein.
25111533 our findings identify mincle as a contributor to the inflammatory response after traumatic brain injury
24733387 These results demonstrated that GroMM is a unique ligand for human Mincle that is not recognized by mouse Mincle.
24721577 mincle is a fungal receptor that can suppress antifungal immunity and, as such, is a potential therapeutic target.
24101491 Results show the molecular mechanism of glycolipid recognition through C-type lectin receptors, which may provide clues to rational design for effective adjuvants.
22932191 Macrophage-inducible C-type lectin is associated with anti-cyclic citrullinated peptide antibodies-positive rheumatoid arthritis in men.
22698596 Mincle is a potentially critical player in human B cell responses.
22641025 Data indicate an unusual pattern of reciprocal expression of Mincle on peripheral blood monocytes or neutrophils.
More...

AA Sequence

MNSSKSSETQCTERGCFSSQMFLWTVAGIPILFLSACFITRCVVTFRIFQTCDEKKFQLPENFTELSCYN      1 - 70
YGSGSVKNCCPLNWEYFQSSCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIG     71 - 140
LSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICEMVGI    141 - 210
NPLNKGKSL                                                                 211 - 219
//

Text Mined References (27)

PMID Year Title
26456705 2015 Induction of Mincle by Helicobacter pylori and consequent anti-inflammatory signaling denote a bacterial survival strategy.
26296894 2015 Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses.
26202982 2015 Contribution of MINCLE-SYK Signaling to Activation of Primary Human APCs by Mycobacterial Cord Factor and the Novel Adjuvant TDB.
25111533 2015 Mincle signaling in the innate immune response after traumatic brain injury.
24733387 2014 Glycerol monomycolate is a novel ligand for the human, but not mouse macrophage inducible C-type lectin, Mincle.
24721577 2014 Fungal engagement of the C-type lectin mincle suppresses dectin-1-induced antifungal immunity.
24101491 2013 Structural analysis for glycolipid recognition by the C-type lectins Mincle and MCL.
22932191 2012 Macrophage-inducible C-type lectin is associated with anti-cyclic citrullinated peptide antibodies-positive rheumatoid arthritis in men.
22698596 2012 Mincle and human B cell function.
22641025 2012 Mincle polarizes human monocyte and neutrophil responses to Candida albicans.
More...