Property Summary

NCBI Gene PubMed Count 16
Grant Count 5
R01 Count 4
Funding $119,304.1
PubMed Score 104.24
PubTator Score 55.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
Rheumatoid Arthritis 2.600 0.015
hepatocellular carcinoma -1.100 0.011
interstitial lung disease -1.700 0.035
Multiple myeloma 2.552 0.010
urothelial carcinoma -1.200 0.026
psoriasis -1.500 0.000
glioblastoma 2.500 0.022
COPD 1.100 0.032
medulloblastoma, large-cell -2.300 0.011
juvenile dermatomyositis 1.356 0.000
acute quadriplegic myopathy 1.569 0.028
adrenocortical carcinoma -2.668 0.001
tuberculosis -2.100 0.003
pancreatic ductal adenocarcinoma liver m... 3.086 0.004
non-small cell lung cancer -1.509 0.000
Hydrolethalus syndrome 1.984 0.036
lung cancer -3.900 0.000
active ulcerative colitis 2.094 0.021
group 4 medulloblastoma -2.300 0.002
lung adenocarcinoma -1.811 0.000
Breast cancer -2.400 0.000
breast carcinoma -1.700 0.000
spina bifida -1.885 0.036
gastric carcinoma 2.300 0.003
pituitary cancer -4.000 0.000
Down syndrome 2.100 0.042
chronic rhinosinusitis -2.370 0.007
cystic fibrosis and chronic rhinosinusit... -1.859 0.049
pancreatic cancer 1.700 0.029
dermatomyositis 3.400 0.003

Synonym

Accession Q9ULX9 B4DV49 Q9Y525
Symbols U-MAF
hMafF

Gene

PANTHER Protein Class (1)

Gene RIF (5)

PMID Text
24118457 MAF genes have different levels of biological and genetic relevance. Besides, MAFF and MAFG could be associated with the susceptibility to develop CML.
19723544 Only in the presence of both MIP and hMafF could the nUS2-pLacZi reporter in yeast genome be activated.
16549056 Expression of hMafF or MIP alone did not alter basal reporter transcription activity, whereas co-expression of hMafF and MIP activated transcription efficiently.
16371591 In myometrial cells we observed an important induction by interleukin 1 beta and a weaker upregulation by tumor necrosis factor, whereas interleukin 6 treatment had no effect.
12490281 MafF/NFE2 hetrodimers act as weak transcriptional activators, and, in particular, are able to stimulate activity of the GCS1 promoter.

AA Sequence

MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLKNRGYAASCRV      1 - 70
KRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPATLVAPASVITIV     71 - 140
KSTPGSGSGPAHGPDPAHGPASCS                                                  141 - 164
//

Text Mined References (16)

PMID Year Title
24118457 2014 Small MAF genes variants and chronic myeloid leukemia.
19723544 2009 Establish a recombinant yeast detection system to study the effect of MIP on transactivation function of hMafF in US2-driven gene transcription.
16549056 2006 The novel human gene MIP functions as a co-activator of hMafF.
16371591 2006 Regulation of the MAFF transcription factor by proinflammatory cytokines in myometrial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12490281 Cloning MafF by recognition site screening with the NFE2 tandem repeat of HS2: analysis of its role in globin and GCSl genes regulation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11772409 2002 Differential induction of mafF, mafG and mafK expression by electrophile-response-element activators.
More...