Property Summary

NCBI Gene PubMed Count 17
PubMed Score 108.67
PubTator Score 55.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
active ulcerative colitis 2.094 2.1e-02
acute quadriplegic myopathy 1.569 2.8e-02
adrenocortical carcinoma -1.682 7.1e-06
Breast cancer -1.500 2.7e-22
breast carcinoma -1.700 1.2e-21
chronic rhinosinusitis -1.309 1.2e-02
COPD 1.100 3.2e-02
cystic fibrosis and chronic rhinosinusit... -1.859 4.9e-02
dermatomyositis 3.400 2.8e-03
Down syndrome 2.100 4.2e-02
gastric carcinoma 2.300 3.5e-03
glioblastoma 2.500 2.2e-02
group 4 medulloblastoma -2.300 2.0e-03
hepatocellular carcinoma -1.100 1.1e-02
Hydrolethalus syndrome 1.984 3.6e-02
interstitial lung disease -1.600 3.5e-02
juvenile dermatomyositis 1.356 1.6e-04
lung adenocarcinoma -1.811 6.0e-05
lung cancer -1.600 6.9e-03
medulloblastoma, large-cell -2.300 1.1e-02
Multiple myeloma 2.552 1.0e-02
non-small cell lung cancer -1.332 6.5e-11
pancreatic cancer 1.700 2.9e-02
pancreatic ductal adenocarcinoma liver m... 3.086 3.7e-03
pituitary cancer -1.300 4.2e-05
psoriasis 1.100 3.0e-04
Rheumatoid arthritis 2.600 1.5e-02
spina bifida -1.829 3.7e-02
tuberculosis -1.700 1.1e-03
urothelial carcinoma -1.200 2.6e-02

Gene RIF (5)

AA Sequence

MSVDPLSSKALKIKRELSENTPHLSDEALMGLSVRELNRHLRGLSAEEVTRLKQRRRTLKNRGYAASCRV      1 - 70
KRVCQKEELQKQKSELEREVDKLARENAAMRLELDALRGKCEALQGFARSVAAARGPATLVAPASVITIV     71 - 140
KSTPGSGSGPAHGPDPAHGPASCS                                                  141 - 164
//

Text Mined References (17)

PMID Year Title