Property Summary

NCBI Gene PubMed Count 15
Grant Count 26
R01 Count 14
Funding $4,332,778.68
PubMed Score 73.38
PubTator Score 38.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Gene RIF (4)

PMID Text
24374484 Data indicate that carbonic anhydrase isoform XIV (hCA XIV) shows high sequence identity with the other membrane-associated carbonic anhydrases (hCAs).
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20170095 Results indicate that some derivatives showed potent hCA IX and hCA XIV inhibitory effects at nanomolar concentrations as well as low affinity for the ubiquitous hCA II.
17881426 No mutation was found in the coding regions and intron-exon boundaries of the genes for CA II, CA IV, CA XIV, kNCB1, NHE3, NHE8, NHRF1, NHRF2 and SLC26A6 amplified from genomic DNA of family members with pRTA.

AA Sequence

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD      1 - 70
QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD     71 - 140
SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF    141 - 210
RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ    211 - 280
AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA                 281 - 337
//

Text Mined References (25)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24374484 2014 The structural comparison between membrane-associated human carbonic anhydrases provides insights into drug design of selective inhibitors.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20170095 2010 Identification of 3,4-Dihydroisoquinoline-2(1H)-sulfonamides as potent carbonic anhydrase inhibitors: synthesis, biological evaluation, and enzyme--ligand X-ray studies.
19206230 2009 Non-zinc mediated inhibition of carbonic anhydrases: coumarins are a new class of suicide inhibitors.
19186056 2009 A thiabendazole sulfonamide shows potent inhibitory activity against mammalian and nematode alpha-carbonic anhydrases.
18618712 2009 Crystal structure of human carbonic anhydrase XIII and its complex with the inhibitor acetazolamide.
17881426 2008 Familial pure proximal renal tubular acidosis--a clinical and genetic study.
More...