Property Summary

Ligand Count 415
NCBI Gene PubMed Count 15
PubMed Score 76.56
PubTator Score 38.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy -1.196 2.3e-07
atypical teratoid / rhabdoid tumor 4.200 2.7e-07
glioblastoma 1.600 2.1e-03
group 3 medulloblastoma -1.300 4.8e-02
medulloblastoma, large-cell 1.500 8.3e-05
ovarian cancer 1.400 2.6e-11
primitive neuroectodermal tumor 1.100 4.7e-02
psoriasis 1.100 4.9e-03

Gene RIF (4)

AA Sequence

MLFSALLLEVIWILAADGGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYD      1 - 70
QPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYD     71 - 140
SDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYF    141 - 210
RYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQ    211 - 280
AGSSYTTGEMLSLGVGILVGCLCLLLAVYFIARKIRKKRLENRKSVVFTSAQATTEA                 281 - 337
//

Text Mined References (25)

PMID Year Title