Property Summary

NCBI Gene PubMed Count 27
PubMed Score 13.17
PubTator Score 11.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.6e-05
medulloblastoma, large-cell 6241 2.0e-04
psoriasis 6694 3.1e-04
adult high grade glioma 3801 4.6e-04
Atopic dermatitis 952 1.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hypertrichosis 46 3.213 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.300 4.6e-04
Atopic dermatitis 1.100 1.9e-02
medulloblastoma, large-cell -1.100 2.0e-04
osteosarcoma -1.436 1.6e-05
psoriasis 1.700 3.1e-04

Gene RIF (7)

AA Sequence

MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYGYGMATSHSWE      1 - 70
MPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLY     71 - 140
RSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQ    141 - 210
CMSGASRLPSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQ    211 - 280
GGSPDEPDSKATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKG    281 - 350
ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV    351 - 420
GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIHQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLF    421 - 490
IPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLERYLKGENPFTDSPEEEKEQE    491 - 560
EAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAVSPPPPPPPEEEEEGAVPLLGGALQRQIRGI    561 - 630
PGLDVEDDEEGGGGAP                                                          631 - 646
//

Text Mined References (38)

PMID Year Title