Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
R01 Count 4
Funding $491,989
PubMed Score 12.98
PubTator Score 11.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma -1.436 0.000
medulloblastoma, large-cell -1.100 0.000
Atopic dermatitis 1.100 0.019
adult high grade glioma -1.300 0.000

Synonym

Accession Q9ULX6 B4DJ74 B5BU90 O94792 Q96J58 Q9NRQ0 Q9UGM0 AKAP8-like protein
Symbols HA95
HAP95
NAKAP
NAKAP95

Gene

Gene RIF (8)

PMID Text
26076356 Gene dosage at 19p13.12, and AKAP8 and/or AKAP8L in particular, play an important role in modulation of head size and may contribute to autism risk.
25034436 HAP95 is incorporated into HIV-1 Gag/Gag-Pol virus-like particle instead of HIV-1 Gag virus-like particle, suggesting a role of Pol in the incorporation of HAP95 into virus particles
25034436 HAP95 is incorporated into HIV-1 Gag/Gag-Pol virus-like particle instead of HIV-1 Gag virus-like particle, suggesting a role of Pol in the incorporation of HAP95 into virus particles
22190034 HAP95 is incorporated into HIV-1 Gag/Gag-Pol virus-like particle instead of HIV-1 Gag virus-like particle, suggesting a role of Pol in the incorporation of HAP95 into virus particles
18313049 These results infer that RNF43 is a resident protein of the ER and, at least partially, the nuclear membrane, with ubiquitin ligase activity and may be involved in cell growth control potentially through the interaction with HAP95.
17594903 Nuclear PKA C subunit co-locates with HA95 in splicing factor compartments and regulates pre-mRNA splicing, possibly through a cAMP-independent mechanism.
16391387 NAKAP-HypA scaffold is a potential nuclear docking site for huntingtin protein and may contribute to the nuclear accumulation of huntingtin observed in HD
12950172 Results indicate that in vitro, the interaction between HA95 and LAP2beta is influenced by a PKA-mediated phosphorylation of HA95 rather than by CDK1- or PKC-mediated phosphorylation of LAP2beta

AA Sequence

MSYTGFVQGSETTLQSTYSDTSAQPTCDYGYGTWNSGTNRGYEGYGYGYGYGQDNTTNYGYGMATSHSWE      1 - 70
MPSSDTNANTSASGSASADSVLSRINQRLDMVPHLETDMMQGGVYGSGGERYDSYESCDSRAVLSERDLY     71 - 140
RSGYDYSELDPEMEMAYEGQYDAYRDQFRMRGNDTFGPRAQGWARDARSGRPMASGYGRMWEDPMGARGQ    141 - 210
CMSGASRLPSLFSQNIIPEYGMFQGMRGGGAFPGGSRFGFGFGNGMKQMRRTWKTWTTADFRTKKKKRKQ    211 - 280
GGSPDEPDSKATRTDCSDNSDSDNDEGTEGEATEGLEGTEAVEKGSRVDGEDEEGKEDGREEGKEDPEKG    281 - 350
ALTTQDENGQTKRKLQAGKKSQDKQKKRQRDRMVERIQFVCSLCKYRTFYEDEMASHLDSKFHKEHFKYV    351 - 420
GTKLPKQTADFLQEYVTNKTKKTEELRKTVEDLDGLIHQIYRDQDLTQEIAMEHFVKKVEAAHCAACDLF    421 - 490
IPMQFGIIQKHLKTMDHNRNRRLMMEQSKKSSLMVARSILNNKLISKKLERYLKGENPFTDSPEEEKEQE    491 - 560
EAEGGALDEGAQGEAAGISEGAEGVPAQPPVPPEPAPGAVSPPPPPPPEEEEEGAVPLLGGALQRQIRGI    561 - 630
PGLDVEDDEEGGGGAP                                                          631 - 646
//

Text Mined References (37)

PMID Year Title
26076356 2015 Reciprocal Relationship between Head Size, an Autism Endophenotype, and Gene Dosage at 19p13.12 Points to AKAP8 and AKAP8L.
25034436 2014 The role of A-kinase anchoring protein 95-like protein in annealing of tRNALys3 to HIV-1 RNA.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21911577 2011 A physical interaction network of dengue virus and human proteins.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...