Property Summary

NCBI Gene PubMed Count 22
PubMed Score 40.05
PubTator Score 28.27

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Pulmonary function (finding) 33
Disease Target Count P-value
interstitial cystitis 2299 7.92479428108234E-4
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 3.547 1.8
Disease Target Count
Uncombable hair syndrome 2


  Differential Expression (1)

Disease log2 FC p
interstitial cystitis -3.700 0.001


Accession Q9ULW8 Q58EY7 Q70SX5
Symbols PAD3


PANTHER Protein Class (1)

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

MLP Assay (10)

AID Type Active / Inconclusive / Inactive Description
588438 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 1 against PAD1-4
588471 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 3 against PAD1-4
588472 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 14 against PAD1-4
588484 confirmatory 0 / 0 / 1 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 10 against PAD1-4
588486 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 21 against PAD1-4
588487 other 35 / 0 / 44 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): fluorescence-based biochemical gel-based competitive Activity-Based Protein Profiling (ABPP) inhibition by HTS hits of PADs 1-4
588488 other 0 / 0 / 34 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of HTS hits against PAD1-4
588490 confirmatory 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to assess potency of compound 17 against PAD1-4
588560 other 12 / 0 / 18 Late stage assay provider results from the probe development effort to identify inhibitors of PAD4: colorimetric biochemical substrate assay to identify inhibitors of PADs 1-4
651866 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inhibitors of Protein Arginine Deiminase 4 (PAD4): colorimetric biochemical substrate assay to determine rate constants of test compounds for PAD 3 inactivation

Gene RIF (10)

26255191 We identified the presence of PADI3 mRNA expression in synovial tissue and PADI2 and PADI4 mRNA expressions in fibroblast-like synoviocytes from patients with rheumatoid arthritis.
24901704 The prevalence and extent of ILD was markedly higher among RA patients with anti-PAD3/4 cross-reactive antibodies, even after accounting for relevant confounders, particularly among ever smokers.
22684066 Crystals of PAD3 obtained using polyethylene glycol 400 as a precipitant diffracted to 2.95 A resolution using synchrotron radiation
18952102 These results reveal the molecular bases of the expression specificity of PADI1 and PADI3 during keratinocyte differentiation through a long-range enhancer and support a model of PADI gene regulation depending on c-Jun-JunD competition.
18923650 Peptidylarginine deiminase Intergenic Enhancer is a strong enhancer of the PADI3 promoter in Ca2+-differentiated epidermal keratinocytes, and requires bound
18083705 cytoplasmic S100A3 within the cuticular layer is mostly co-localized with the type III isoform of peptidylarginine deiminase (PAD3)
16671893 PADI3 expression is driven by Sp1/Sp3 and NF-Y binding to the promoter region
16091842 PAD3 is co-located with filaggrin within the filamentous matrix of the deeper corneocytes where the protein is deiminated.
15675958 PAD1 and 3 are able to modify filaggrin
15150696 peptidylarginine deiminase types 1 and 3 loci map to chromosomal band 1p36.13

AA Sequence

IDDFTPYHMLHGEVHCGTNVCRKPFSFKWWNMVP                                        631 - 664

Text Mined References (23)

PMID Year Title
26255191 2016 The amount of citrullinated proteins in synovial tissue is related to serum anti-cyclic citrullinated peptide (anti-CCP) antibody levels.
25416956 2014 A proteome-scale map of the human interactome network.
24901704 2014 Association of cross-reactive antibodies targeting peptidyl-arginine deiminase 3 and 4 with rheumatoid arthritis-associated interstitial lung disease.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
22684066 2012 Crystallization and preliminary X-ray crystallographic analysis of human peptidylarginine deiminase type III.
18952102 2008 Long-range enhancer differentially regulated by c-Jun and JunD controls peptidylarginine deiminase-3 gene in keratinocytes.
18923650 2008 Long-range enhancer associated with chromatin looping allows AP-1 regulation of the peptidylarginine deiminase 3 gene in differentiated keratinocyte.
18083705 2008 Specific citrullination causes assembly of a globular S100A3 homotetramer: a putative Ca2+ modulator matures human hair cuticle.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16973334 2006 Peptidylarginine deiminases and deimination in biology and pathology: relevance to skin homeostasis.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16671893 2006 NF-Y and Sp1/Sp3 are involved in the transcriptional regulation of the peptidylarginine deiminase type III gene (PADI3) in human keratinocytes.
16091842 2005 The peptidylarginine deiminases expressed in human epidermis differ in their substrate specificities and subcellular locations.
15675958 2005 Peptidylarginine deiminase isoforms 1-3 are expressed in the epidermis and involved in the deimination of K1 and filaggrin.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15150696 2004 Identification of 45 novel SNPs in the 83-kb region containing peptidylarginine deiminase types 1 and 3 loci on chromosomal band 1p36.13.
15087120 2004 Comparative analysis of the mouse and human peptidylarginine deiminase gene clusters reveals highly conserved non-coding segments and a new human gene, PADI6.
14579251 2003 PAD, a growing family of citrullinating enzymes: genes, features and involvement in disease.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.
11069618 2000 Human peptidylarginine deiminase type III: molecular cloning and nucleotide sequence of the cDNA, properties of the recombinant enzyme, and immunohistochemical localization in human skin.
10092850 1999 Molecular cloning of cDNAs of mouse peptidylarginine deiminase type I, type III and type IV, and the expression pattern of type I in mouse.