Property Summary

Ligand Count 6
NCBI Gene PubMed Count 24
PubMed Score 41.71
PubTator Score 28.27

Knowledge Summary


No data available


  Differential Expression (1)

Disease log2 FC p
interstitial cystitis -2.500 1.1e-02

Gene RIF (12)

AA Sequence

IDDFTPYHMLHGEVHCGTNVCRKPFSFKWWNMVP                                        631 - 664

Text Mined References (25)

PMID Year Title