Property Summary

NCBI Gene PubMed Count 8
PubMed Score 86.91
PubTator Score 7.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.31237810846054E-40
Breast cancer 3099 1.05697089639607E-21
ovarian cancer 8492 4.49784457416549E-12
oligodendroglioma 2849 7.33184009162482E-11
malignant mesothelioma 3163 5.10138511637767E-9
colon cancer 1475 5.70015900911112E-9
medulloblastoma, large-cell 6234 2.0142045515527E-8
atypical teratoid / rhabdoid tumor 4369 4.28102890609367E-7
pediatric high grade glioma 2712 1.00155512470123E-5
glioblastoma 5572 4.05759212436329E-5
group 3 medulloblastoma 2254 2.49982963672065E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0013472681161589
psoriasis 6685 0.00206677459588862
astrocytic glioma 2241 0.00241644261814016
primitive neuroectodermal tumor 3031 0.00256004736417306
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00316576857943018
ependymoma 2514 0.00409533015476283
cutaneous lupus erythematosus 1056 0.00583752764731778
subependymal giant cell astrocytoma 2287 0.00778654073250624
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0117386560587876
gastric cancer 436 0.0171976376442275
lung cancer 4473 0.0211509059300857
Disease Target Count Z-score Confidence
spina bifida 1064 3.035 1.5

Expression

Synonym

Accession Q9ULW6 B2RE61 B4E161 Q8TAN6
Symbols BPX

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Pig OMA EggNOG Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (1)

PMID Text
21333655 Results identified several proteins interacting with NAP1L2, including the ubiquitously expressed members of the nucleosome assembly protein family, NAP1L1 and NAP1L4.

AA Sequence

MAESENRKELSESSQEEAGNQIMVEGLGEHLERGEDAAAGLGDDGKCGEEAAAGLGEEGENGEDTAAGSG      1 - 70
EDGKKGGDTDEDSEADRPKGLIGYVLDTDFVESLPVKVKYRVLALKKLQTRAANLESKFLREFHDIERKF     71 - 140
AEMYQPLLEKRRQIINAIYEPTEEECEYKSDSEDCDDEEMCHEEMYGNEEGMVHEYVDEDDGYEDYYYDY    141 - 210
AVEEEEEEEEEDDIEATGEENKEEEDPKGIPDFWLTVLKNVDTLTPLIKKYDEPILKLLTDIKVKLSDPG    211 - 280
EPLSFTLEFHFKPNEYFKNELLTKTYVLKSKLAYYDPHPYRGTAIEYSTGCEIDWNEGKNVTLKTIKKKQ    281 - 350
KHRIWGTIRTVTEDFPKDSFFNFFSPHGITSNGRDGNDDFLLGHNLRTYIIPRSVLFFSGDALESQQEGV    351 - 420
VREVNDAIYDKIIYDNWMAAIEEVKACCKNLEALVEDIDR                                  421 - 460
//

Text Mined References (10)

PMID Year Title
21333655 2011 Interaction between nucleosome assembly protein 1-like family members.
18985028 2008 Hepatitis C virus infection protein network.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12116227 2002 SNPs in the CpG island of NAP1L2: a possible link between DNA methylation and neural tube defects?
10932189 2000 Control of neurulation by the nucleosome assembly protein-1-like 2.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8789438 1996 Cloning and characterization of a murine brain specific gene Bpx and its human homologue lying within the Xic candidate region.