Property Summary

NCBI Gene PubMed Count 14
Grant Count 3
R01 Count 3
Funding $479,306.25
PubMed Score 5.20
PubTator Score 6.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9ULW5 B2RAA6 Q3L6K5 Q6NXS7
Symbols V46133

Gene

PDB

2G6B  

 GO Function (2)

Gene RIF (6)

PMID Text
25643395 Rab26 selectively directs synaptic and secretory vesicles into preautophagosomal structures.
24413166 Increased RAB26 expression causes lysosomes to coalesce in a central, perinuclear region within the cell.
23105096 The small GTPase Rab26 regulates the Golgi to cell surface traffic of alpha(2)-adrenergic receptors, likely through a physical interaction.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20038531 MIST1 binds to highly conserved CATATG E-boxes to directly activate transcription of 6 genes, including those encoding the small GTPases RAB26 and RAB3D.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVG      1 - 70
DSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHAL     71 - 140
LLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKT    141 - 210
GLNVDLAFTAIAKELKQRSMKAPSEPRFRLHDYVKREGRGASCCRP                            211 - 256
//

Text Mined References (15)

PMID Year Title
25643395 2015 The GTPase Rab26 links synaptic vesicles to the autophagy pathway.
24413166 2014 RAB26 coordinates lysosome traffic and mitochondrial localization.
23105096 2012 Rab26 modulates the cell surface transport of ?2-adrenergic receptors from the Golgi.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20038531 2010 RAB26 and RAB3D are direct transcriptional targets of MIST1 that regulate exocrine granule maturation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16696853 2006 A yeast 2-hybrid analysis of human GTP cyclohydrolase I protein interactions.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...