Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.20
PubTator Score 6.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
oligodendroglioma 2849 3.80353875447556E-14
posterior fossa group A ependymoma 1511 4.51157863056985E-11
atypical teratoid / rhabdoid tumor 4369 5.25852154453397E-11
ovarian cancer 8492 3.26867820900818E-9
malignant mesothelioma 3163 1.00457210797455E-6
glioblastoma 5572 2.07224439383751E-6
pediatric high grade glioma 2712 2.62942580908315E-6
Breast cancer 3099 6.03623288682317E-5
astrocytoma 1493 8.79610713378966E-5
primitive neuroectodermal tumor 3031 1.01032724446855E-4
Pick disease 1893 4.04389974694908E-4
primary Sjogren syndrome 789 0.00128566549123771
medulloblastoma, large-cell 6234 0.00167866287499767
pancreatic cancer 2300 0.0020411952984571
invasive ductal carcinoma 2950 0.00333705740290624
pilocytic astrocytoma 3086 0.00396623315504984
primary pancreatic ductal adenocarcinoma 1271 0.00400874030610154
ductal carcinoma in situ 1745 0.00695543574884185
group 4 medulloblastoma 1875 0.0119241704956479
subependymal giant cell astrocytoma 2287 0.0169776203927719
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0265274658847923
gastric carcinoma 832 0.0498997276071364
Disease Target Count Z-score Confidence
Polycystic kidney disease 54 3.419 1.7

Expression

Synonym

Accession Q9ULW5 B2RAA6 Q3L6K5 Q6NXS7
Symbols V46133

Gene

PDB

2G6B  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid

 GO Function (2)

Gene RIF (6)

PMID Text
25643395 Rab26 selectively directs synaptic and secretory vesicles into preautophagosomal structures.
24413166 Increased RAB26 expression causes lysosomes to coalesce in a central, perinuclear region within the cell.
23105096 The small GTPase Rab26 regulates the Golgi to cell surface traffic of alpha(2)-adrenergic receptors, likely through a physical interaction.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20038531 MIST1 binds to highly conserved CATATG E-boxes to directly activate transcription of 6 genes, including those encoding the small GTPases RAB26 and RAB3D.
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVG      1 - 70
DSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHAL     71 - 140
LLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKT    141 - 210
GLNVDLAFTAIAKELKQRSMKAPSEPRFRLHDYVKREGRGASCCRP                            211 - 256
//

Text Mined References (15)

PMID Year Title
25643395 2015 The GTPase Rab26 links synaptic vesicles to the autophagy pathway.
24413166 2014 RAB26 coordinates lysosome traffic and mitochondrial localization.
23105096 2012 Rab26 modulates the cell surface transport of ?2-adrenergic receptors from the Golgi.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20038531 2010 RAB26 and RAB3D are direct transcriptional targets of MIST1 that regulate exocrine granule maturation.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
16696853 2006 A yeast 2-hybrid analysis of human GTP cyclohydrolase I protein interactions.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...