Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.20
PubTator Score 3.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (2)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.4e-05
malignant mesothelioma 1.800 2.3e-07

AA Sequence

MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYG      1 - 70
EVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVAASLHNTPMGARRRSPFRY     71 - 140
DLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWT    141 - 210
FAQRPTEQELRARKAARPGGRERARLATAQDKARSNKGLLARIFGAPPPSESMEGPSLVRDS            211 - 272
//

Text Mined References (13)

PMID Year Title