Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.23
PubTator Score 16.54

Knowledge Summary

Patent (10,344)

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.100 4.1e-02
Breast cancer 2.900 3.2e-02
colon cancer 2.600 1.0e-02
cystic fibrosis -1.600 1.5e-05
ependymoma 1.200 1.5e-03
esophageal adenocarcinoma -1.900 2.1e-02
lung cancer 5.500 1.8e-07
non-small cell lung cancer 1.725 6.7e-06
ovarian cancer 2.400 6.7e-05
primitive neuroectodermal tumor 1.300 4.1e-02
psoriasis -1.100 3.9e-08
spina bifida -1.152 3.6e-02

 MGI Phenotype (1)

Gene RIF (4)

AA Sequence

MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHE      1 - 70
FAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNK     71 - 140
NDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPL    141 - 210
CTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIR    211 - 280
LFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAN    281 - 350
SSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL    351 - 420
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTL    421 - 490
DCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKA    491 - 560
QHPQKTHHGKYEIPAQSPTCV                                                     561 - 581
//

Text Mined References (18)

PMID Year Title