Property Summary

NCBI Gene PubMed Count 16
Grant Count 3
Funding $36,012.5
PubMed Score 23.47
PubTator Score 16.54

Knowledge Summary

Patent (10,344)

Expression

  Differential Expression (12)

Disease log2 FC p
esophageal adenocarcinoma -1.900 0.021
posterior fossa group A ependymoma 1.300 0.001
atypical teratoid / rhabdoid tumor 2.100 0.041
primitive neuroectodermal tumor 1.300 0.041
non-small cell lung cancer 1.725 0.000
colon cancer 2.600 0.010
lung cancer 5.500 0.000
Breast cancer 2.900 0.032
cystic fibrosis -1.600 0.000
psoriasis -1.100 0.000
spina bifida -1.152 0.036
ovarian cancer 2.400 0.000

Synonym

Accession Q9ULW2 Fz-10
Symbols Fz10
FzE7
CD350
FZ-10
hFz10

Gene

 MGI Term (1)

Gene RIF (3)

PMID Text
20634891 Observational study of gene-disease association. (HuGE Navigator)
19137009 FZD10 transactivation causes the activation of the Dvl-Rac1-JNK pathway and is associated with the development/progression of synovial sarcomas
19134005 there was a strong inverse correlation between nuclear immunostaining scores for beta-catenin expression and expression patterns of FZD10

AA Sequence

MQRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHE      1 - 70
FAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNK     71 - 140
NDPNYLCMEAPNNGSDEPTRGSGLFPPLFRPQRPHSAQEHPLKDGGPGRGGCDNPGKFHHVEKSASCAPL    141 - 210
CTPGVDVYWSREDKRFAVVWLAIWAVLCFFSSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYLIR    211 - 280
LFAGAESIACDRDSGQLYVIQEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAN    281 - 350
SSYFHLAAWAIPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL    351 - 420
FHIRRVMKTGGENTDKLEKLMVRIGLFSVLYTVPATCVIACYFYERLNMDYWKILAAQHKCKMNNQTKTL    421 - 490
DCLMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQQVCSRRLKKKSRRKPASVITSGGIYKKA    491 - 560
QHPQKTHHGKYEIPAQSPTCV                                                     561 - 581
//

Text Mined References (16)

PMID Year Title
22780124 2013 Genome-wide association study of a quantitative disordered gambling trait.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20227380 2010 Development of a bioassay for detection of Wnt-binding affinities for individual frizzled receptors.
20037267 2009 Transcriptional profiling and Wnt signaling activation in proliferation of human hepatic stellate cells induced by PDGF-BB.
19188438 2009 Myocilin is a modulator of Wnt signaling.
19137009 2009 Activation of the non-canonical Dvl-Rac1-JNK pathway by Frizzled homologue 10 in human synovial sarcoma.
19134005 2009 Inverse correlation of the up-regulation of FZD10 expression and the activation of beta-catenin in synchronous colorectal tumors.
18271942 2008 Radioimmunotherapy of human synovial sarcoma using a monoclonal antibody against FZD10.
16007199 2005 Therapeutic potential of antibodies against FZD 10, a cell-surface protein, for synovial sarcomas.
15930302 2005 Hypoxia-inducible protein 2 (HIG2), a novel diagnostic marker for renal cell carcinoma and potential target for molecular therapy.
More...