Property Summary

NCBI Gene PubMed Count 76
Grant Count 18
R01 Count 9
Funding $1,235,352.4
PubMed Score 165.65
PubTator Score 104.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (53)

PMID Text
27053618 MiR-491 inhibits hepatocellular carcinoma cell proliferation, invasion and migration by downregulating the expression of TPX2.
26624896 expression of both TPX2 and PD-L1 are associated with persistence/recurrence of cervical intraepithelial neoplasia after cervical conization
26414402 Data show that cytoskeleton associated protein 5 (chTOG) only weakly promotes importin-regulated microtubule nucleation, but acts synergistically with TPX2 protein.
26279431 TPX2 was a target gene of miR-491.
26257190 the levels and distribution of TPX2 are likely to be determinants of when and where kinesin-5 acts in neurons.
26240182 Aurora A-dependent TPX2 phosphorylation controls mitotic spindle length through regulating microtubule flux.
26018074 Dimeric, but not monomeric, Eg5 was differentially inhibited by full-length and truncated TPX2, demonstrating that dimerization or residues in the neck region are important for the interaction of TPX2 with Eg5.
25914189 These results indicated that TPX2 has an impact on tumor angiogenesis in pancreatic cancer.
25830658 a causative link between altered function of AURKA-HMMR-TPX2-TUBG1 and breast carcinogenesis in BRCA1/2 mutation carriers
25632068 Propose TPX2 and AURKA as novel co-regulators on the MYC pathway in colorectal neoplasms.
More...

AA Sequence

MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAI      1 - 70
VTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKM     71 - 140
KAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKST    141 - 210
EEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKE    211 - 280
VNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDD    281 - 350
INLLPSKSSVTKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK    351 - 420
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFA    421 - 490
LKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSFDSRDKERQLQKEKKIKELQK    491 - 560
GEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRRGALKAQTWKHQLEEELRQQKEAACFKARPN    561 - 630
TVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK    631 - 700
KEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHC                           701 - 747
//

Text Mined References (88)

PMID Year Title
27053618 2016 [miR-491 inhibits the proliferation, invasion and migration of hepatocellular carcinoma cell via down-regulating TPX2 expression].
26624896 2015 Positive Surgical Margin, HPV Persistence, and Expression of Both TPX2 and PD-L1 Are Associated with Persistence/Recurrence of Cervical Intraepithelial Neoplasia after Cervical Conization.
26414402 2015 Complementary activities of TPX2 and chTOG constitute an efficient importin-regulated microtubule nucleation module.
26279431 2015 Low Expression of miR-491 Promotes Esophageal Cancer Cell Invasion by Targeting TPX2.
26257190 2015 TPX2 regulates neuronal morphology through kinesin-5 interaction.
26240182 2015 TPX2 phosphorylation maintains metaphase spindle length by regulating microtubule flux.
26165940 2015 GM130 Regulates Golgi-Derived Spindle Assembly by Activating TPX2 and Capturing Microtubules.
26018074 2015 TPX2 Inhibits Eg5 by Interactions with Both Motor and Microtubule.
25914189 2015 Therapeutic potential of targeting protein for Xklp2 silencing for pancreatic cancer.
25830658 2015 Assessing associations between the AURKA-HMMR-TPX2-TUBG1 functional module and breast cancer risk in BRCA1/2 mutation carriers.
More...