Property Summary

NCBI Gene PubMed Count 85
PubMed Score 180.01
PubTator Score 104.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adrenocortical carcinoma 3.021 4.9e-08
adult high grade glioma 2.200 5.8e-05
Atopic dermatitis 1.400 2.3e-03
atypical teratoid / rhabdoid tumor 3.200 1.3e-13
Breast cancer 4.100 2.2e-02
breast carcinoma 1.200 1.1e-04
colon cancer 1.700 1.4e-02
ductal carcinoma in situ 2.200 1.2e-03
Endometriosis 1.711 1.5e-02
ependymoma 1.700 5.2e-07
glioblastoma 2.800 2.2e-09
group 3 medulloblastoma 3.300 1.5e-06
interstitial cystitis 1.600 6.0e-03
intraductal papillary-mucinous carcinoma... 2.000 3.7e-04
intraductal papillary-mucinous neoplasm ... 2.500 1.4e-03
invasive ductal carcinoma 3.400 1.2e-04
lung adenocarcinoma 1.300 8.5e-08
lung cancer 2.300 1.8e-03
malignant mesothelioma 1.300 5.4e-07
medulloblastoma, large-cell 3.800 2.1e-08
nasopharyngeal carcinoma 1.100 1.1e-04
non-small cell lung cancer 4.036 2.4e-40
ovarian cancer 2.700 3.7e-08
pancreatic cancer 1.700 4.2e-07
primitive neuroectodermal tumor 3.100 1.1e-06
psoriasis 1.500 7.9e-08

Gene RIF (57)

AA Sequence

MSQVKSSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLENKLLGKNGTGGLFQGKTPLRKANLQQAI      1 - 70
VTPLKPVDNTYYKEAEKENLVEQSIPSNACSSLEVEAAISRKTPAQPQRRSLRLSAQKDLEQKEKHHVKM     71 - 140
KAKRCATPVIIDEILPSKKMKVSNNKKKPEEEGSAHQDTAEKNASSPEKAKGRHTVPCMPPAKQKFLKST    141 - 210
EEQELEKSMKMQQEVVEMRKKNEEFKKLALAGIGQPVKKSVSQVTKSVDFHFRTDERIKQHPKNQEEYKE    211 - 280
VNFTSELRKHPSSPARVTKGCTIVKPFNLSQGKKRTFDETVSTYVPLAQQVEDFHKRTPNRYHLRSKKDD    281 - 350
INLLPSKSSVTKICRDPQTPVLQTKHRARAVTCKSTAELEAEELEKLQQYKFKARELDPRILEGGPILPK    351 - 420
KPPVKPPTEPIGFDLEIEKRIQERESKKKTEDEHFEFHSRPCPTKILEDVVGVPEKKVLPITVPKSPAFA    421 - 490
LKNRIRMPTKEDEEEDEPVVIKAQPVPHYGVPFKPQIPEARTVEICPFSFDSRDKERQLQKEKKIKELQK    491 - 560
GEVPKFKALPLPHFDTINLPEKKVKNVTQIEPFCLETDRRGALKAQTWKHQLEEELRQQKEAACFKARPN    561 - 630
TVISQEPFVPKKEKKSVAEGLSGSLVQEPFQLATEKRAKERQELEKRMAEVEAQKAQQLEEARLQEEEQK    631 - 700
KEELARLRRELVHKANPIRKYQGLEIKSSDQPLTVPVSPKFSTRFHC                           701 - 747
//

Text Mined References (98)

PMID Year Title