Property Summary

NCBI Gene PubMed Count 24
Grant Count 30
R01 Count 11
Funding $3,467,269.48
PubMed Score 1.75
PubTator Score 88.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
non-small cell lung cancer 1.896 0.000
pancreatic cancer 1.300 0.000
interstitial cystitis -1.700 0.000
lung adenocarcinoma 1.100 0.000
ulcerative colitis -1.300 0.001

 MGI Term (1)

Gene RIF (10)

PMID Text
26393512 Data suggest that ubiquitin ligase CBLC controls mostly network organization of the Golgi Apparatus.
25883215 Silencing of CBLC causes increased sensitivity to PARP1 inhibitor olaparib in breast cancer cell line models and that defective homologous recombination (HR) DNA repair is the likely cause.
25809485 the effects of two pathogenic missense mutations on the the catalytic activities of the human B12-processing chaperone CblC
24599607 This retrospective multicentre study evaluates clinical, biochemical and genetic findings in 88 cblC patients
23145173 The ubiquitin ligase activity of Cbl-c by the direct interaction of the LIM zinc coordinating domain of Hic5 is demonstrated.
20525694 the N terminus of Cbl-c contributes to the binding to the E2 and phosphorylation of Tyr-341 leads to a decrease in affinity and an increase in the E3 activity of Cbl-c
15117950 ubiquitin protein ligase activity is regulated in c-Cbl by phosphorylation-induced conformational change and constitutive activation by tyrosine to glutamate point mutations
14661060 Src is a preferential target of Cbl-c for degradation
12244174 c-Cbl is a negative regulator of hepatocyte growth factor/receptor tyrosine kinase Met signaling in B cells, mediating ubiquitination and, consequently, proteosomal degradation of Met, with a role in Met-mediated tumorigenesis.
12226085 Data demonstrate that two E3 ligases of different classes, CBLC and AIP4, can interact and cooperate to down-regulate EGFR signaling.

AA Sequence

MALAVAPWGRQWEEARALGRAVRMLQRLEEQCVDPRLSVSPPSLRDLLPRTAQLLREVAHSRRAAGGGGP      1 - 70
GGPGGSGDFLLIYLANLEAKSRQVAALLPPRGRRSANDELFRAGSRLRRQLAKLAIIFSHMHAELHALFP     71 - 140
GGKYCGHMYQLTKAPAHTFWRESCGARCVLPWAEFESLLGTCHPVEPGCTALALRTTIDLTCSGHVSIFE    141 - 210
FDVFTRLFQPWPTLLKNWQLLAVNHPGYMAFLTYDEVQERLQACRDKPGSYIFRPSCTRLGQWAIGYVSS    211 - 280
DGSILQTIPANKPLSQVLLEGQKDGFYLYPDGKTHNPDLTELGQAEPQQRIHVSEEQLQLYWAMDSTFEL    281 - 350
CKICAESNKDVKIEPCGHLLCSCCLAAWQHSDSQTCPFCRCEIKGWEAVSIYQFHGQATAEDSGNSSDQE    351 - 420
GRELELGQVPLSAPPLPPRPDLPPRKPRNAQPKVRLLKGNSPPAALGPQDPAPA                    421 - 474
//

Text Mined References (27)

PMID Year Title
26393512 2015 The Ubiquitin Ligase CBLC Maintains the Network Organization of the Golgi Apparatus.
25883215 2015 Complementary genetic screens identify the E3 ubiquitin ligase CBLC, as a modifier of PARP inhibitor sensitivity.
25809485 2015 Pathogenic mutations differentially affect the catalytic activities of the human B12-processing chaperone CblC and increase futile redox cycling.
24599607 2014 Clinical presentation and outcome in a series of 88 patients with the cblC defect.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23145173 2012 Cbl-c ubiquitin ligase activity is increased via the interaction of its RING finger domain with a LIM domain of the paxillin homolog, Hic 5.
22888118 2012 Structural flexibility regulates phosphopeptide-binding activity of the tyrosine kinase binding domain of Cbl-c.
22315494 2012 CBL mutations in myeloproliferative neoplasms are also found in the gene's proline-rich domain and in patients with the V617FJAK2.
20525694 2010 The N terminus of Cbl-c regulates ubiquitin ligase activity by modulating affinity for the ubiquitin-conjugating enzyme.
18753381 2008 CD2AP and Cbl-3/Cbl-c constitute a critical checkpoint in the regulation of ret signal transduction.
More...