Property Summary

NCBI Gene PubMed Count 35
Grant Count 61
R01 Count 45
Funding $9,638,371.74
PubMed Score 629.12
PubTator Score 64.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.670 0.000
glioblastoma -1.100 0.011

 GO Component (1)

Gene RIF (27)

PMID Text
26319152 BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.
26003728 Nuclear HSF2 and HSF4 bound to HSF1 only after heat shock.
25940838 HSF4 may work as a switch between lens epithelial cell proliferation and secondary fiber cell differentiation, a process which mainly depends on p53.
25877371 concluded that the new mutation of c.331C>T in HSF4 DNA may be responsible for the autosomal dominant congenital cataract in this family
25088997 We found that HSF4 downregulation led to decrease of HIF1alpha mRNA expression
24975927 HSF4 p.Arg116His recreates the childhood lamellar cataract in mice suggesting that incomplete penetrance associated with early cataracts may not be an absence but a limitation of the detection of the phenotype
24637349 This is the first report of the novel missense mutation, c.69 G-->T (p. K23N), in exon 3 of the HSF4 locus on 16q21-q22 associated with bilateral congenital cataracts in a Chinese family.
24045990 the transcriptional activation of HSF4 is mediated by interactions between activator and repressor domains within the C-terminal end.
23507146 HSF4 exerts its function on lens differentiation via positive regulation of DLAD expression.
23329665 HSF4 and WRN CNVs might be involved in ARC pathogenesis in the Han Chinese.
More...

AA Sequence

MQEAPAALPTEPGPSPVPAFLGKLWALVGDPGTDHLIRWSPSGTSFLVSDQSRFAKEVLPQYFKHSNMAS      1 - 70
FVRQLNMYGFRKVVSIEQGGLLRPERDHVEFQHPSFVRGREQLLERVRRKVPALRGDDGRWRPEDLGRLL     71 - 140
GEVQALRGVQESTEARLRELRQQNEILWREVVTLRQSHGQQHRVIGKLIQCLFGPLQAGPSNAGGKRKLS    141 - 210
LMLDEGSSCPTPAKFNTCPLPGALLQDPYFIQSPLPETNLGLSPHRARGPIISDIPEDSPSPEGTRLSPS    211 - 280
SDGRREKGLALLKEEPASPGGDGEAGLALAPNECDFCVTAPPPLPVAVVQAILEGKGSFSPEGPRNAQQP    281 - 350
EPGDPREIPDRGPLGLESGDRSPESLLPPMLLQPPQESVEPAGPLDVLGPSLQGREWTLMDLDMELSLMQ    351 - 420
PLVPERGEPELAVKGLNSPSPGKDPTLGAPLLLDVQAALGGPALGLPGALTIYSTPESRTASYLGPEASP    421 - 490
SP                                                                        491 - 492
//

Text Mined References (38)

PMID Year Title
26319152 2015 BCAS2 interacts with HSF4 and negatively regulates its protein stability via ubiquitination.
26003728 2015 Heat shock-induced interactions among nuclear HSFs detected by fluorescence cross-correlation spectroscopy.
25940838 2015 HSF4 promotes G1/S arrest in human lens epithelial cells by stabilizing p53.
25877371 2015 A novel HSF4 mutation in a Chinese family with autosomal dominant congenital cataract.
25088997 2014 Effect of HSF4b on age related cataract may through its novel downstream target Hif1?.
24975927 2014 HSF4 mutation p.Arg116His found in age-related cataracts and in normal populations produces childhood lamellar cataract in transgenic mice.
24637349 2014 A novel HSF4 gene mutation causes autosomal-dominant cataracts in a Chinese family.
24045990 2013 Functional analysis of HSF4 mutations found in patients with autosomal recessive congenital cataracts.
23507146 2013 HSF4 regulates DLAD expression and promotes lens de-nucleation.
23329665 2013 Copy number variations of DNA repair genes and the age-related cataract: Jiangsu Eye Study.
More...