Property Summary

NCBI Gene PubMed Count 29
Grant Count 5
R01 Count 5
Funding $247,379.8
PubMed Score 23.45
PubTator Score 21.99

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (13)

PMID Text
25862165 Coro1C mediated Rac1 trafficking through actin-rich vesicles.
25518741 Data indicate that coronin 1C protein (CORO1C) was a direct target of the microRNA miR-1/133a cluster in EBC-1 CORO1C was a direct target of the miR-1/133a cluster in lung-squamous cell carcinoma cell line EBC-1.
23292607 Coronin-1C overexpression is associated withand hepatocellular carcinoma growth through enhancement of tumor cell proliferation and migration, which are correlated with Rac-1 activation.
22974233 Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K.
20690162 There is a strong expression of both SELPLG and coronin-1C in the majority of primary effusion lymphomas, irrespective of their gene dosage. SELPLG is critical for cell migration and chemotaxis, while CORO1C regulates actin-dependent processes.
20678442 Patients with higher coronin-1C expression had a more advanced stage of hepatocellular carcinoma.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
19913511 Coronin 1C negatively regulates epithelial cell migration via FAK-mediated inhibition of cell-matrix adhesion.
19651142 Fndings postulate a role for CRN2 isoforms in the structural and functional organization of F-actin in highly ordered protein complexes.
More...

AA Sequence

MRRVVRQSKFRHVFGQAVKNDQCYDDIRVSRVTWDSSFCAVNPRFVAIIIEASGGGAFLVLPLHKTGRID      1 - 70
KSYPTVCGHTGPVLDIDWCPHNDQVIASGSEDCTVMVWQIPENGLTLSLTEPVVILEGHSKRVGIVAWHP     71 - 140
TARNVLLSAGCDNAIIIWNVGTGEALINLDDMHSDMIYNVSWNRNGSLICTASKDKKVRVIDPRKQEIVA    141 - 210
EKEKAHEGARPMRAIFLADGNVFTTGFSRMSERQLALWNPKNMQEPIALHEMDTSNGVLLPFYDPDTSII    211 - 280
YLCGKGDSSIRYFEITDESPYVHYLNTFSSKEPQRGMGYMPKRGLDVNKCEIARFFKLHERKCEPIIMTV    281 - 350
PRKSDLFQDDLYPDTAGPEAALEAEEWFEGKNADPILISLKHGYIPGKNRDLKVVKKNILDSKPTANKKC    351 - 420
DLISIPKKTTDTASVQNEAKLDEILKEIKSIKDTICNQDERISKLEQQMAKIAA                    421 - 474
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25862165 2015 Integration of the Rac1- and actin-binding properties of Coronin-1C.
25518741 2015 Downregulation of the microRNA-1/133a cluster enhances cancer cell migration and invasion in lung-squamous cell carcinoma via regulation of Coronin1C.
25074804 2014 Coronin-1C and RCC2 guide mesenchymal migration by trafficking Rac1 and controlling GEF exposure.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23292607 2013 Knockdown of Coronin-1C disrupts Rac1 activation and impairs tumorigenic potential in hepatocellular carcinoma cells.
22974233 2012 Coronin 3 promotes gastric cancer metastasis via the up-regulation of MMP-9 and cathepsin K.
22364218 2012 Coronin 1C harbours a second actin-binding site that confers co-operative binding to F-actin.
More...