Property Summary

NCBI Gene PubMed Count 69
PubMed Score 106.82
PubTator Score 70.19

Knowledge Summary

Patent (14,667)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (11)

Disease log2 FC p
breast carcinoma -1.900 9.2e-04
ductal carcinoma in situ -2.100 9.1e-04
fibroadenoma -2.000 2.0e-02
intraductal papillary-mucinous neoplasm ... -1.100 2.4e-02
invasive ductal carcinoma -2.500 8.9e-03
lung adenocarcinoma -1.400 2.6e-17
lung cancer -1.100 3.3e-03
lung carcinoma -1.300 1.7e-07
non-small cell lung cancer -1.475 3.3e-17
osteosarcoma -1.802 1.5e-03
psoriasis -1.300 2.7e-04

 CSPA Cell Line (1)

Protein-protein Interaction (9)

Gene RIF (50)

AA Sequence

MAWRGAGPSVPGAPGGVGLSLGLLLQLLLLLGPARGFGDEEERRCDPIRISMCQNLGYNVTKMPNLVGHE      1 - 70
LQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGMCLSVKRRCEPVLKEFGFAWP     71 - 140
ESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGL    141 - 210
YSRSAKEFTDIWMAVWASLCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERI    211 - 280
SCDFEEAAEPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIA    281 - 350
AWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL    351 - 420
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLKIFMSLLVGIT    421 - 490
SGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV                           491 - 537
//

Text Mined References (74)

PMID Year Title