Property Summary

NCBI Gene PubMed Count 26
PubMed Score 16.10
PubTator Score 12.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (10)

Disease log2 FC p
ependymoma 1.200 3.5e-05
group 4 medulloblastoma -1.800 1.6e-04
interstitial cystitis -1.500 6.9e-04
intraductal papillary-mucinous adenoma (... -1.400 4.8e-04
intraductal papillary-mucinous carcinoma... -1.300 3.2e-03
nasopharyngeal carcinoma 1.500 1.4e-04
osteosarcoma 1.272 1.5e-03
ovarian cancer -1.700 1.8e-06
Pick disease 1.100 1.3e-03
subependymal giant cell astrocytoma -1.790 3.9e-02

Protein-protein Interaction (5)

Gene RIF (15)

AA Sequence

MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSP      1 - 70
SGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVL     71 - 140
GKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPP    141 - 210
RQPTEYFDMGIFLAFFVVVSLVCLILLVKIKLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCG    211 - 280
ALDTLSSSSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVE    281 - 350
TSNLSRGRQQRVTLPVHYPGRVHRTNAIPAYPTRTSMDSHGNPVTLLTMDRHGEQSLYSPQTPAYIRSYP    351 - 420
PLHLDHSLAAHRCGLEHRAYSPAHPFRRPKLSGRSFSKAACFSQYETMYQHYYFQGLSYPEQEGQSPPSL    421 - 490
APRGPARAFPPSGSGSLLFPTVVHVAPPSHLESGSTSSFSCYHGHRSVCSGYLADCPGSDSSSSSSSGQC    491 - 560
HCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYRSRSPCRASEAGGSGSSGRGPALCFEGSPPP    561 - 630
EELPAVHSHGAGRGEPWPGPASPSGDQVSTCSLEMNYSSNSSLEHRGPNSSTSEVGLEASPGAAPDLRRT    631 - 700
WKGGHELPSCACCCEPQPSPAGPSAGAAGSSTLFLGPHLYEGSGPAGGEPQSGSSQGLYGLHPDHLPRTD    701 - 770
GVKYEGLPCCFYEEKQVARGGGGGSGCYTEDYSVSVQYTLTEEPPPGCYPGARDLSQRIPIIPEDVDCDL    771 - 840
GLPSDCQGTHSLGSWGGTRGPDTPRPHRGLGATREEERALCCQARALLRPGCPPEEAGAVRANFPSALQD    841 - 910
TQESSTTATEAAGPRSHSADSSSPGA                                                911 - 936
//

Text Mined References (26)

PMID Year Title