Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.32
PubTator Score 19.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Intestinal Atresia, Multiple 1 0.0 0.0
Disease Target Count P-value
osteosarcoma 7950 2.0e-10
ependymoma 4679 4.3e-10
aldosterone-producing adenoma 665 7.5e-03
active ulcerative colitis 764 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count
Multiple intestinal atresia 1

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis 1.183 1.6e-02
aldosterone-producing adenoma -1.104 7.5e-03
ependymoma 1.200 4.3e-10
osteosarcoma -2.664 2.0e-10

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MAAKGAHGSYLKVESELERCRAEGHWDRMPELVRQLQTLSMPGGGGNRRGSPSAAFTFPDTDDFGKLLLA      1 - 70
EALLEQCLKENHAKIKDSMPLLEKNEPKMSEAKNYLSSILNHGRLSPQYMCEAMLILGKLHYVEGSYRDA     71 - 140
ISMYARAGIDDMSMENKPLYQMRLLSEAFVIKGLSLERLPNSIASRFRLTEREEEVITCFERASWIAQVF    141 - 210
LQELEKTTNNSTSRHLKGCHPLDYELTYFLEAALQSAYVKNLKKGNIVKGMRELREVLRTVETKATQNFK    211 - 280
VMAAKHLAGVLLHSLSEECYWSPLSHPLPEFMGKEESSFATQALRKPHLYEGDNLYCPKDNIEEALLLLL    281 - 350
ISESMATRDVVLSRVPEQEEDRTVSLQNAAAIYDLLSITLGRRGQYVMLSECLERAMKFAFGEFHLWYQV    351 - 420
ALSMVACGKSAYAVSLLRECVKLRPSDPTVPLMAAKVCIGSLRWLEEAEHFAMMVISLGEEAGEFLPKGY    421 - 490
LALGLTYSLQATDATLKSKQDELHRKALQTLERAQQLAPSDPQVILYVSLQLALVRQISSAMEQLQEALK    491 - 560
VRKDDAHALHLLALLFSAQKHHQHALDVVNMAITEHPENFNLMFTKVKLEQVLKGPEEALVTCRQVLRLW    561 - 630
QTLYSFSQLGGLEKDGSFGEGLTMKKQSGMHLTLPDAHDADSGSRRASSIAASRLEEAMSELTMPSSVLK    631 - 700
QGPMQLWTTLEQIWLQAAELFMEQQHLKEAGFCIQEAAGLFPTSHSVLYMRGRLAEVKGNLEEAKQLYKE    701 - 770
ALTVNPDGVRIMHSLGLMLSRLGHKSLAQKVLRDAVERQSTCHEAWQGLGEVLQAQGQNEAAVDCFLTAL    771 - 840
ELEASSPVLPFSIIPREL                                                        841 - 858
//

Text Mined References (31)

PMID Year Title