Property Summary

Ligand Count 3
NCBI Gene PubMed Count 7
PubMed Score 1.22
PubTator Score 1.01

Knowledge Summary

Patent (3,589)

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.400 1.3e-03
astrocytic glioma -1.600 1.4e-02
Astrocytoma, Pilocytic -1.400 5.8e-06
atypical teratoid / rhabdoid tumor -1.100 3.9e-05
ependymoma -1.900 9.6e-03
glioblastoma -1.300 6.0e-07
medulloblastoma -1.600 6.7e-05
oligodendroglioma -1.600 1.6e-02
primitive neuroectodermal tumor -1.400 3.8e-03

AA Sequence

MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFY      1 - 70
FDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSD     71 - 140
QESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSILVVMGSIITMCLNSLP    141 - 210
DFQIPDSQGNPGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLV    211 - 280
VESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTI    281 - 350
EKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ    351 - 420
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLR                 421 - 477
//

Text Mined References (8)

PMID Year Title