Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.22
PubTator Score 1.01

Knowledge Summary

Patent (3,589)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.600 0.014
ependymoma -1.900 0.010
oligodendroglioma -1.600 0.016
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.600 0.000
primitive neuroectodermal tumor -1.400 0.004
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.500 0.000

AA Sequence

MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFY      1 - 70
FDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSD     71 - 140
QESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSILVVMGSIITMCLNSLP    141 - 210
DFQIPDSQGNPGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLV    211 - 280
VESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTI    281 - 350
EKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ    351 - 420
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLR                 421 - 477
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
9305895 1997 New modulatory alpha subunits for mammalian Shab K+ channels.
8640222 1996 Identification and mapping of human cDNAs homologous to Drosophila mutant genes through EST database searching.