Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.22
PubTator Score 1.01

Knowledge Summary

Patent (3,589)

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
atypical teratoid / rhabdoid tumor 4369 1.09186646706744E-8
pilocytic astrocytoma 3086 3.11980664272549E-6
glioblastoma 5572 5.24011265210862E-6
pediatric high grade glioma 2712 4.21445822971342E-5
medulloblastoma 1524 6.72435720648702E-5
primitive neuroectodermal tumor 3031 0.00383305530160928
ependymoma 2514 0.0095892701722432
astrocytic glioma 2241 0.013899091552533
oligodendroglioma 2849 0.0157404328754471
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Essential tremor 30 3.458 1.7

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.600 0.014
ependymoma -1.900 0.010
oligodendroglioma -1.600 0.016
glioblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.700 0.000
medulloblastoma -1.600 0.000
primitive neuroectodermal tumor -1.400 0.004
pediatric high grade glioma -1.400 0.000
pilocytic astrocytoma -1.500 0.000

Synonym

Accession Q9ULS6 A8KAN1
Symbols KV9.2

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA Inparanoid

 MGI Term (1)

AA Sequence

MTGQSLWDVSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCDDYDDVQREFY      1 - 70
FDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCSYSYHGRKVEPEQEKWDEQSD     71 - 140
QESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNPGYSVLSRVFSILSILVVMGSIITMCLNSLP    141 - 210
DFQIPDSQGNPGEDPRFEIVEHFGIAWFTFELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLV    211 - 280
VESTPTLANLGRVAQVLRLMRIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTI    281 - 350
EKEENEGLATIPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ    351 - 420
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLR                 421 - 477
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
9305895 1997 New modulatory alpha subunits for mammalian Shab K+ channels.
8640222 1996 Identification and mapping of human cDNAs homologous to Drosophila mutant genes through EST database searching.