Property Summary

NCBI Gene PubMed Count 4
Grant Count 8
R01 Count 8
Funding $396,522.75
PubMed Score 0.79
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MNGSNMANTSPSVKSKEDQGLSGHDEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRCFQEMLDEEDQ      1 - 70
DWFIPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSNLNPDAKEFIPGEKY                      71 - 123
//

Text Mined References (5)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17381337 2006 Regulation of poly(A)-binding protein through PABP-interacting proteins.
16804161 2006 Regulation of poly(A) binding protein function in translation: Characterization of the Paip2 homolog, Paip2B.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.