Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.79
PubTator Score 1.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 1.7928413528547E-19
acute quadriplegic myopathy 1157 3.05771505383789E-6
pilocytic astrocytoma 3086 6.49975377667608E-6
atypical teratoid/rhabdoid tumor 1095 7.80200862451038E-6
glioblastoma 5572 9.36657005399579E-6
pediatric high grade glioma 2712 1.78981165390742E-5
limb girdle muscular dystrophy 2A 156 1.93099016716863E-5
osteosarcoma 7933 3.41269218295453E-5
posterior fossa group A ependymoma 1511 3.63685063989597E-5
lung cancer 4473 5.74860415787238E-5
pancreatic cancer 2300 1.9415043868087E-4
psoriasis 6685 2.63784798650001E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 3.07149651405096E-4
cutaneous lupus erythematosus 1056 0.0025496173574258
subependymal giant cell astrocytoma 2287 0.00259647063512195
primary pancreatic ductal adenocarcinoma 1271 0.00297680125253533
medulloblastoma, large-cell 6234 0.00323874701815229
Breast cancer 3099 0.00434375922623241
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00446941253584396
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00678537318805989
group 3 medulloblastoma 2254 0.00814042489541881
astrocytic glioma 2241 0.0496936880485515
acute myeloid leukemia 785 0.0499460915868409
Disease Target Count Z-score Confidence
Male infertility 170 3.311 1.7

Expression

Synonym

Gene

  Ortholog (10)

AA Sequence

MNGSNMANTSPSVKSKEDQGLSGHDEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRCFQEMLDEEDQ      1 - 70
DWFIPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSNLNPDAKEFIPGEKY                      71 - 123
//

Text Mined References (5)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17381337 2006 Regulation of poly(A)-binding protein through PABP-interacting proteins.
16804161 2006 Regulation of poly(A) binding protein function in translation: Characterization of the Paip2 homolog, Paip2B.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.