Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.12
PubTator Score 1.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
acute myeloid leukemia -1.700 5.0e-02
acute quadriplegic myopathy -1.426 3.1e-06
adult high grade glioma -2.400 3.9e-04
astrocytic glioma -1.800 5.0e-02
Astrocytoma, Pilocytic -2.000 6.1e-06
atypical teratoid / rhabdoid tumor -1.600 8.9e-04
Breast cancer -1.100 4.3e-03
cutaneous lupus erythematosus -1.700 2.5e-03
ependymoma -1.200 2.3e-05
glioblastoma -2.100 9.4e-06
group 3 medulloblastoma -1.900 8.1e-03
intraductal papillary-mucinous adenoma (... -3.300 3.1e-04
intraductal papillary-mucinous carcinoma... -3.000 6.8e-03
intraductal papillary-mucinous neoplasm ... -3.500 4.5e-03
limb girdle muscular dystrophy 2A -1.095 1.9e-05
lung cancer -3.200 5.7e-05
lung carcinoma 1.800 1.8e-19
medulloblastoma, large-cell -1.900 3.2e-03
osteosarcoma -1.664 3.4e-05
pancreatic cancer -1.700 1.9e-04
primary pancreatic ductal adenocarcinoma -1.779 3.0e-03
psoriasis -1.400 1.2e-09
subependymal giant cell astrocytoma -4.197 2.6e-03

Gene RIF (1)

AA Sequence

MNGSNMANTSPSVKSKEDQGLSGHDEKENPFAEYMWMENEEDFNRQVEEELQEQDFLDRCFQEMLDEEDQ      1 - 70
DWFIPSRDLPQAMGQLQQQLNGLSVSEGHDSEDILSKSNLNPDAKEFIPGEKY                      71 - 123
//

Text Mined References (6)

PMID Year Title