Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.72
PubTator Score 8.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
active Crohn's disease 1.635 4.3e-03
active ulcerative colitis 1.145 5.8e-03
adult high grade glioma -2.500 2.5e-05
astrocytic glioma -2.800 2.7e-03
Astrocytoma, Pilocytic -2.600 4.4e-09
atypical teratoid / rhabdoid tumor -2.700 4.0e-04
breast carcinoma 1.200 1.1e-14
colon cancer 2.200 5.4e-06
cystic fibrosis -2.428 3.9e-05
Endometriosis -1.166 4.4e-02
ependymoma -2.900 6.0e-03
esophageal adenocarcinoma 1.100 1.8e-02
glioblastoma -2.700 1.8e-08
group 3 medulloblastoma -2.400 6.2e-05
interstitial cystitis -1.900 3.7e-04
intraductal papillary-mucinous carcinoma... 1.200 3.0e-03
intraductal papillary-mucinous neoplasm ... 2.100 3.5e-04
invasive ductal carcinoma 1.700 3.3e-04
lung cancer 2.200 2.2e-04
medulloblastoma, large-cell -2.300 2.9e-03
oligodendroglioma -1.500 3.7e-02
osteosarcoma -1.760 2.8e-02
primitive neuroectodermal tumor -2.700 5.3e-04
subependymal giant cell astrocytoma -2.179 2.1e-02

Synonym

Accession Q9ULR3 B1Q2A9 B2RXG4 Q6PI86
Symbols URCC2
ARHCL1
NERPP-2C

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE      1 - 70
TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE     71 - 140
GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA    141 - 210
SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK    211 - 280
LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY    281 - 350
RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD    351 - 420
LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS    421 - 490
NDRLGSGDDISVYVIPLIHGNKLS                                                  491 - 514
//

Text Mined References (21)

PMID Year Title