Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.57
PubTator Score 8.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.37919851556119E-16
oligodendroglioma 2849 5.63921659599527E-16
breast carcinoma 1614 1.13139689208775E-14
pilocytic astrocytoma 3086 1.73661784940568E-9
pediatric high grade glioma 2712 2.10788173900512E-9
glioblastoma 5572 1.00492634727194E-7
group 4 medulloblastoma 1875 1.27276392089956E-6
colon cancer 1475 5.43465001287263E-6
cystic fibrosis 1670 3.94215493288926E-5
lung cancer 4473 2.18056760023975E-4
invasive ductal carcinoma 2950 3.25424736960377E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.49172218856447E-4
interstitial cystitis 2299 3.70514553180304E-4
atypical teratoid / rhabdoid tumor 4369 4.01001343544284E-4
primitive neuroectodermal tumor 3031 5.25477491861358E-4
astrocytic glioma 2241 0.00266485152666599
medulloblastoma, large-cell 6234 0.00288989013134999
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00298083394256356
active Crohn's disease 918 0.00427441613474941
active ulcerative colitis 477 0.0057522267362631
esophageal adenocarcinoma 737 0.0176010007179145
subependymal giant cell astrocytoma 2287 0.0208224969891864
osteosarcoma 7933 0.0278165863629937
Endometriosis 535 0.0438077809007131
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0

Expression

Synonym

Accession Q9ULR3 B1Q2A9 B2RXG4 Q6PI86
Symbols URCC2
ARHCL1
NERPP-2C

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (6)

PMID Text
24732009 PPM1H acts as a gatekeeper to prevent excessive BMP signaling through dephosphorylation and subsequent nuclear exclusion of P-Smad1/5/8 proteins.
22586611 Knockdown of the serine/threonine phosphatase PPM1H confers trastuzumab resistance via reduction in protein levels of the tumor suppressor p27.
20732627 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20659327 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18059182 PPM1H, overexpressed in colon adenocarcinoma, is associated with CSE1L protein.

AA Sequence

MLTRVKSAVANFMGGIMAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKE      1 - 70
TRRLPWATGYAEVINAGKSTHNEDQASCEVLTVKKKAGAVTSTPNRNSSKRRSSLPNGEGLQLKENSESE     71 - 140
GVSCHYWSLFDGHAGSGAAVVASRLLQHHITEQLQDIVDILKNSAVLPPTCLGEEPENTPANSRTLTRAA    141 - 210
SLRGGVGAPGSPSTPPTRFFTEKKIPHECLVIGALESAFKEMDLQIERERSSYNISGGCTALIVICLLGK    211 - 280
LYVANAGDSRAIIIRNGEIIPMSSEFTPETERQRLQYLAFMQPHLLGNEFTHLEFPRRVQRKELGKKMLY    281 - 350
RDFNMTGWAYKTIEDEDLKFPLIYGEGKKARVMATIGVTRGLGDHDLKVHDSNIYIKPFLSSAPEVRIYD    351 - 420
LSKYDHGSDDVLILATDGLWDVLSNEEVAEAITQFLPNCDPDDPHRYTLAAQDLVMRARGVLKDRGWRIS    421 - 490
NDRLGSGDDISVYVIPLIHGNKLS                                                  491 - 514
//

Text Mined References (20)

PMID Year Title
24732009 2014 Specific control of BMP signaling and mesenchymal differentiation by cytoplasmic phosphatase PPM1H.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22586611 2011 PPM1H is a p27 phosphatase implicated in trastuzumab resistance.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
20732627 2010 Case-control genome-wide association study of attention-deficit/hyperactivity disorder.
20659327 2010 Trait-stratified genome-wide association study identifies novel and diverse genetic associations with serologic and cytokine phenotypes in systemic lupus erythematosus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...