Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.00
PubTator Score 2.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Laryngeal squamous cell carcinoma 3 3.51 1.8

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRI      1 - 70
RDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEP     71 - 140
LPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEE    141 - 210
EINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEAR    211 - 280
RLLGY                                                                     281 - 285
//

Text Mined References (15)

PMID Year Title