Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.00
PubTator Score 2.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9ULR0 Q96IL2 Q9BT05
Symbols FSAP33

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
16103217 Describes the function of yeast Isy1p in pre-mRNA splicing.

AA Sequence

MARNAEKAMTALARFRQAQLEEGKVKERRPFLASECTELPKAEKWRRQIIGEISKKVAQIQNAGLGEFRI      1 - 70
RDLNDEINKLLREKGHWEVRIKELGGPDYGKVGPKMLDHEGKEVPGNRGYKYFGAAKDLPGVRELFEKEP     71 - 140
LPPPRKTRAELMKAIDFEYYGYLDEDDGVIVPLEQEYEKKLRAELVEKWKAEREARLARGEKEEEEEEEE    141 - 210
EINIYAVTEEESDEEGSQEKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEEAR    211 - 280
RLLGY                                                                     281 - 285
//

Text Mined References (14)

PMID Year Title
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17981804 2008 Isolation of XAB2 complex involved in pre-mRNA splicing, transcription, and transcription-coupled repair.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16103217 2005 The Isy1p component of the NineTeen complex interacts with the ATPase Prp16p to regulate the fidelity of pre-mRNA splicing.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...