Property Summary

NCBI Gene PubMed Count 22
Grant Count 10
R01 Count 9
Funding $640,462.75
PubMed Score 59.27
PubTator Score 87.66

Knowledge Summary

Patent (693)

Expression

Gene RIF (10)

PMID Text
26152696 Studies suggest that both two-pore channels TPC1 and TPC2 as nicotinic acid adenine dinucleotide phosphate (NAADP) targets.
25722412 TPC1 and TPC2 proteins play a key role in Ebola virus infection and may be effective targets for antiviral therapy.
25665131 The TPC1 was shown to interact with citron kinase, with TPC1 overexpression affecting RhoA activity and myosin light chain phosphorylation levels in cytokinesis.
25451935 NAADP induced marked Ca(2+) transients in HEK293 cells that stably coexpressed hTPC2 with hTPC1 or cTPC3, but failed to evoke any such response in cells that coexpressed interacting hTPC2 and rTPC3 subunits
25157141 TPC2, but not TPC1, caused a proliferation of endolysosomal structures, dysregulating intracellular trafficking, and cellular pigmentation.
24847115 NAADP triggers H+ release from lysosomes and endolysomes through activation of TPC1, but that the Ca2+ -releasing ability of TPC1 will depend on the ionic composition of the acidic stores
24776928 TPC1 is a member of a new family of voltage-gated Na(+) channels that senses pH changes and confers electrical excitability to organelles.
22500018 The concerted regulation of TPC1 activity by luminal Ca(2+) and by membrane potential thus provides a potential mechanism to explain NAADP-induced Ca(2+) oscillations.
22270358 OsTPC1 plays a crucial role in TvX-induced Ca(2+) influx as a plasma membrane Ca(2+)-permeable channel consequently required for the regulation of phytoalexin biosynthesis
19620632 Data show that human two-pore channel TPC1 is critical for nicotinic acid adenine dinucleotide phosphate action and is likely the long sought after target channel for NAADP.

AA Sequence

MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSPSSPAHNWEMN      1 - 70
YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLLLLSLCEAPAVPALRLGIYVH     71 - 140
ATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVLVVQFVEAIVVLVRQMSHVRVTRALRCIFLV    141 - 210
DCRYCGGVRRNLRQIFQSLPPFMDILLLLLFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTA    211 - 280
NFPDVMMPSYSRNPWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLI    281 - 350
SQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF    351 - 420
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYLVFLTIYGVEL    421 - 490
FLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRPLQLLRLFKLKERYRNVLDTM    491 - 560
FELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNTSTVADAYRWRNHTVGNRTVVEEGYYYLNNF    561 - 630
DNILNSFVTLFELTVVNNWYIIMEGVTSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKN    631 - 700
QDSEVDGGITLEKEISKEELVAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSL    701 - 770
KMYQEEIQEWYEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT                            771 - 816
//

Text Mined References (25)

PMID Year Title
26152696 2015 Function and dysfunction of two-pore channels.
25722412 2015 Ebola virus. Two-pore channels control Ebola virus host cell entry and are drug targets for disease treatment.
25665131 2015 Two-pore channel 1 interacts with citron kinase, regulating completion of cytokinesis.
25451935 2015 Organelle-specific subunit interactions of the vertebrate two-pore channel family.
25157141 2014 The Two-pore channel (TPC) interactome unmasks isoform-specific roles for TPCs in endolysosomal morphology and cell pigmentation.
24847115 2014 Reconstituted human TPC1 is a proton-permeable ion channel and is activated by NAADP or Ca2+.
24776928 2014 The voltage-gated sodium channel TPC1 confers endolysosomal excitability.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24188827 2013 Hax-1 identified as a two-pore channel (TPC)-binding protein.
23149075 2013 Preliminary evidence of genetic determinants of adiponectin response to fenofibrate in the Genetics of Lipid Lowering Drugs and Diet Network.
More...