Property Summary

NCBI Gene PubMed Count 23
PubMed Score 66.72
PubTator Score 87.66

Knowledge Summary

Patent (693)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Oligospermia 36 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Thyroid cancer 36 5.727 2.9

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.300 9.4e-03
atypical teratoid/rhabdoid tumor -1.100 2.6e-05
oligodendroglioma 1.100 2.8e-03
posterior fossa group A ependymoma -1.100 1.9e-07
primary pancreatic ductal adenocarcinoma -1.032 1.4e-02
tuberculosis 1.100 4.7e-05

Gene RIF (11)

AA Sequence

MAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSKNGGSYAIHDSQAPSLSSGGESSPSSPAHNWEMN      1 - 70
YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLLLLSLCEAPAVPALRLGIYVH     71 - 140
ATLELFALMVVVFELCMKLRWLGLHTFIRHKRTMVKTSVLVVQFVEAIVVLVRQMSHVRVTRALRCIFLV    141 - 210
DCRYCGGVRRNLRQIFQSLPPFMDILLLLLFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLLTTA    211 - 280
NFPDVMMPSYSRNPWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKRKFKSLLLHKRTAIQHAYRLLI    281 - 350
SQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWF    351 - 420
DELPRTALLIFKGINILVKSKAFQYFMYLVVAVNGVWILVETFMLKGGNFFSKHVPWSYLVFLTIYGVEL    421 - 490
FLKVAGLGPVEYLSSGWNLFDFSVTVFAFLGLLALALNMEPFYFIVVLRPLQLLRLFKLKERYRNVLDTM    491 - 560
FELLPRMASLGLTLLIFYYSFAIVGMEFFCGIVFPNCCNTSTVADAYRWRNHTVGNRTVVEEGYYYLNNF    561 - 630
DNILNSFVTLFELTVVNNWYIIMEGVTSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYSRKN    631 - 700
QDSEVDGGITLEKEISKEELVAVLELYREARGASSDVTRLLETLSQMERYQQHSMVFLGRRSRTKSDLSL    701 - 770
KMYQEEIQEWYEEHAREQEQQRQLSSSAAPAAQQPPGSRQRSQTVT                            771 - 816
//

Text Mined References (26)

PMID Year Title