Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.66
PubTator Score 3.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 5.34791195371901E-89
posterior fossa group A ependymoma 1511 6.81458915082636E-10
sonic hedgehog group medulloblastoma 1482 1.69159103381564E-6
pituitary cancer 1972 3.0508865145595E-6
ulcerative colitis 2087 3.80349834016908E-6
pediatric high grade glioma 2712 2.86587105694807E-5
pilocytic astrocytoma 3086 5.29330462276784E-5
acute quadriplegic myopathy 1157 5.61998390654509E-5
glioblastoma 5572 8.055631733733E-5
medulloblastoma, large-cell 6234 7.93185100000507E-4
primitive neuroectodermal tumor 3031 0.00249850663107813
atypical teratoid / rhabdoid tumor 4369 0.00379207082101554
diabetes mellitus 1663 0.00399011207908361
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00667360167150247

Expression

Synonym

Accession Q9ULQ0 Q8WUZ4
Symbols FAM40B
FAR11B

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid

Gene RIF (1)

PMID Text
25531779 this study propose that the STRIPAK complex, FAM40A, FAM40B and STRN3, regulates the mode of cancer cell migration by controlling the activity of MST3 and 4, which locally coordinate the phosphorylation of ERM proteins and inhibit the dephosphorylation of MLC leading to increased actin-membrane linkage.

AA Sequence

MEDPAAPGTGGPPANGNGNGGGKGKQAAPKGREAFRSQRRESEGSVDCPTLEFEYGDADGHAAELSELYS      1 - 70
YTENLEFTNNRRCFEEDFKTQVQGKEWLELEEDAQKAYIMGLLDRLEVVSRERRLKVARAVLYLAQGTFG     71 - 140
ECDSEVDVLHWSRYNCFLLYQMGTFSTFLELLHMEIDNSQACSSALRKPAVSIADSTELRVLLSVMYLMV    141 - 210
ENIRLERETDPCGWRTARETFRTELSFSMHNEEPFALLLFSMVTKFCSGLAPHFPIKKVLLLLWKVVMFT    211 - 280
LGGFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLT    281 - 350
KQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVAFPKGLPW    351 - 420
APKVRQKDIEHFLEMSRNKFIGFTLGQDTDTLVGLPRPIHESVKTLKQHKYISIADVQIKNEEELEKCPM    421 - 490
SLGEEVVPETPCEILYQGMLYSLPQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPITVLQSMKLG    491 - 560
IDVNRHKEIIVKSISTLLLLLLKHFKLNHIYQFEYVSQHLVFANCIPLILKFFNQNILSYITAKNSISVL    561 - 630
DYPCCTIQDLPELTTESLEAGDNSQFCWRNLFSCINLLRLLNKLTKWKHSRTMMLVVFKSAPILKRALKV    631 - 700
KQAMLQLYVLKLLKLQTKYLGRQWRKSNMKTMSAIYQKVRHRMNDDWAYGNDIDARPWDFQAEECTLRAN    701 - 770
IEAFNSRRYDRPQDSEFSPVDNCLQSVLGQRLDLPEDFHYSYELWLEREVFSQPICWEELLQNH          771 - 834
//

Text Mined References (15)

PMID Year Title
25531779 2015 STRIPAK components determine mode of cancer cell migration and metastasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22782902 2012 The protein factor-arrest 11 (Far11) is essential for the toxicity of human caspase-10 in yeast and participates in the regulation of autophagy and the DNA damage signaling.
22298706 2012 TORC2 signaling is antagonized by protein phosphatase 2A and the Far complex in Saccharomyces cerevisiae.
21834987 2011 Identification and characterization of a set of conserved and new regulators of cytoskeletal organization, cell morphology and migration.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...