Property Summary

NCBI Gene PubMed Count 23
PubMed Score 144.96
PubTator Score 35.58

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.500 1.6e-03
astrocytic glioma -1.800 1.9e-02
atypical teratoid / rhabdoid tumor -1.300 1.2e-04
Breast cancer 2.100 3.1e-02
ependymoma -2.400 2.9e-02
glioblastoma -1.100 3.1e-04
medulloblastoma, large-cell -1.200 5.2e-04
nasopharyngeal carcinoma 1.100 1.6e-03
osteosarcoma 2.264 6.2e-07
ovarian cancer 1.100 2.7e-03
Pick disease 1.500 1.2e-03
primitive neuroectodermal tumor -1.100 6.4e-03
Rheumatoid arthritis 1.200 5.5e-03
subependymal giant cell astrocytoma -1.541 2.8e-02
tuberculosis 1.100 1.8e-03

Gene RIF (15)

AA Sequence

MDSPGYNCFVDKDKMDAAIQDLGPKELSCTELQELKQLARQGYWAQSHALRGKVYQRLIRDIPCRTVTPD      1 - 70
ASVYSDIVGKIVGKHSSSCLPLPEFVDNTQVPSYCLNARGEGAVRKILLCLANQFPDISFCPALPAVVAL     71 - 140
LLHYSIDEAECFEKACRILACNDPGRRLIDQSFLAFESSCMTFGDLVNKYCQAAHKLMVAVSEDVLQVYA    141 - 210
DWQRWLFGELPLCYFARVFDVFLVEGYKVLYRVALAILKFFHKVRAGQPLESDSVKQDIRTFVRDIAKTV    211 - 280
SPEKLLEKAFAIRLFSRKEIQLLQMANEKALKQKGITVKQKSVSLSKRQFVHLAVHAENFRSEIVSVREM    281 - 350
RDIWSWVPERFALCQPLLLFSSLQHGYSLARFYFQCEGHEPTLLLIKTTQKEVCGAYLSTDWSERNKFGG    351 - 420
KLGFFGTGECFVFRLQPEVQRYEWVVIKHPELTKPPPLMAAEPTAPLSHSASSDPADRLSPFLAARHFNL    421 - 490
PSKTESMFMAGGSDCLIVGGGGGQALYIDGDLNRGRTSHCDTFNNQPLCSENFLIAAVEAWGFQDPDTQ     491 - 559
//

Text Mined References (26)

PMID Year Title