Property Summary

NCBI Gene PubMed Count 36
Grant Count 4
R01 Count 4
Funding $383,750
PubMed Score 34.30
PubTator Score 22.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
astrocytic glioma -1.300 0.022
esophageal adenocarcinoma -1.300 0.018
psoriasis 1.100 0.000
glioblastoma -2.100 0.003
oligodendroglioma -1.200 0.000
posterior fossa group A ependymoma -2.000 0.000
group 3 medulloblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -2.300 0.003
medulloblastoma, large-cell -3.400 0.000
Atopic dermatitis 1.100 0.004
adrenocortical carcinoma -2.134 0.030
interstitial cystitis -1.300 0.008
lung adenocarcinoma -1.300 0.000
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -1.400 0.000
Pick disease -2.100 0.000

Gene RIF (16)

PMID Text
26976975 Study shows that NDRG4 was significantly up-regulated in glioblastomas (GBM) and seems to play a role in GBM prognosis. These results indicate that NDRG4 gene in MGMT-methylated cells is a putative tumor-suppressor gene and an oncogene in cells with unmethylated MGMT.
26053091 These findings bring novel insight to the roles of NDRG4 in meningioma progression
25520251 Two downregulated genes, NDRG4 and GINS3, have been located in a genomic interval associated with cardiac repolarization in published GWASs and zebra fish knockout models
25241110 A homozygous variant in NDRG4 may be the causative variant of the autosomal recessive form of infantile myofibromatosis.
24993691 Methylation level in stool decreases dramatically following colorectal cancer resection
23725756 summarizes the current research on NDRG3 and NDRG4,including the molecular structure, cellular and tissue distribution, biological function, and function in cancer.
22869042 NDRG4 is involved in modulating cell proliferation, invasion, migration and angiogenesis in meningioma, and may play a valuable role as a molecular target in its treatment
22489821 Over expression of NDRG4 inhibited proliferation of GBM cells.
22399192 expression of NDRG4 is downregulated in human gliomas. The glioma patients with lower NDRG4 expression have a poor prognosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDA      1 - 70
PGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLVNID     71 - 140
PNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQIGNVVNQANLQLFWNMYNSRRD    141 - 210
LDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFK    211 - 280
YFLQGMGYIAYLKDRRLSGGAVPSASMTRLARSRTASLTSASSVDGSRPQACTHSESSEGLGQVNHTMEV    281 - 350
SC                                                                        351 - 352
//

Text Mined References (37)

PMID Year Title
26976975 2016 NDRG2 and NDRG4 Expression Is Altered in Glioblastoma and Influences Survival in Patients with MGMT-methylated Tumors.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26053091 2015 NDRG4 is a novel oncogenic protein and p53 associated regulator of apoptosis in malignant meningioma cells.
25520251 2015 Adipose tissue gene expression and metabolic health of obese adults.
25416956 2014 A proteome-scale map of the human interactome network.
25241110 Exome sequencing identifies a novel homozygous variant in NDRG4 in a family with infantile myofibromatosis.
24993691 2014 Stool methylated DNA markers decrease following colorectal cancer resection--implications for surveillance.
23725756 2013 NDRG3 and NDRG4, two novel tumor-related genes.
22869042 2012 NDRG4, the N-Myc downstream regulated gene, is important for cell survival, tumor invasion and angiogenesis in meningiomas.
22726844 2012 A common variant in SLC8A1 is associated with the duration of the electrocardiographic QT interval.
More...