Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.500 0.003
ependymoma -1.900 0.000
oligodendroglioma -1.500 0.000
glioblastoma -2.300 0.000
sonic hedgehog group medulloblastoma -2.400 0.000
atypical teratoid / rhabdoid tumor -2.200 0.000
medulloblastoma, large-cell -2.600 0.000
primitive neuroectodermal tumor -1.800 0.000
adrenocortical carcinoma -1.027 0.007
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -1.700 0.000
subependymal giant cell astrocytoma -1.942 0.048
psoriasis -1.300 0.000

Synonym

Accession Q9ULN7 C9JGD5 M0R374 Q08E79 Q0D2F9 Q6ZVD1
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MAMSLLQDWCRSLDVDAHRALLVTGIPEGLEQADVEAVLQPTLLPLGTFRLRHMKALMNEKAQAALVEFV      1 - 70
EDVNHAAIPREIPGKDGVWRVLWKDRAQDTRVLRQMRRLLLDDGPTQAAEAGTPGEAPTPPASETQAQDS     71 - 140
GEVTGQAGSLLGAARNPRRGRRGRRNRTRRNRLTQKGKKRSRGGRPSAPARSEAEDSSDESLGIVIEEID    141 - 210
QGDLSGEEDQSALYATLQAAARELVRQWAPCNSEGGPCPTCPWEGIGGFGCDLTVQTRLSQSYVRDTQM     211 - 279
//

Text Mined References (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.