Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma -1.027 7.2e-03
adult high grade glioma -2.300 1.6e-06
astrocytic glioma -1.500 2.8e-03
Astrocytoma, Pilocytic -1.700 2.2e-08
atypical teratoid / rhabdoid tumor -2.200 4.5e-08
ependymoma -1.700 3.7e-03
glioblastoma -2.200 4.1e-12
group 3 medulloblastoma -1.500 1.6e-03
medulloblastoma, large-cell -2.600 1.1e-04
oligodendroglioma -1.400 2.4e-02
primitive neuroectodermal tumor -1.800 1.1e-04
psoriasis -1.300 1.5e-54
subependymal giant cell astrocytoma -1.942 4.8e-02

AA Sequence

MAMSLLQDWCRSLDVDAHRALLVTGIPEGLEQADVEAVLQPTLLPLGTFRLRHMKALMNEKAQAALVEFV      1 - 70
EDVNHAAIPREIPGKDGVWRVLWKDRAQDTRVLRQMRRLLLDDGPTQAAEAGTPGEAPTPPASETQAQDS     71 - 140
GEVTGQAGSLLGAARNPRRGRRGRRNRTRRNRLTQKGKKRSRGGRPSAPARSEAEDSSDESLGIVIEEID    141 - 210
QGDLSGEEDQSALYATLQAAARELVRQWAPCNSEGGPCPTCPWEGIGGFGCDLTVQTRLSQSYVRDTQM     211 - 279
//

Text Mined References (5)

PMID Year Title