Property Summary

NCBI Gene PubMed Count 26
Grant Count 2
Funding $49,544
PubMed Score 17.36
PubTator Score 5.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9ULM6 A7MD46 D3DWR0
Symbols CCR4
Ccr4a

Gene

 Grant Application (2)

Gene RIF (7)

PMID Text
26792405 miR-29c-3p promotes the senescence of Mesenchymal stem cells by targeting CNOT6 through p53-p21 and p16-pRB pathways.
25944446 These results indicate that Caf1 and Ccr4 cooperate in mRNA deadenylation and suggest that the enzyme activities of Caf1 and Ccr4 are regulated via allosteric interactions within the nuclease module.
21233283 Results identified CNOT6/CNOT6L as a key regulator of insulin-like growth factor-binding protein 5, which mediates cell cycle arrest and senescence via a p53-dependent pathway.
19558367 Data show that Ccr4-Not function in RNA splicing and nuclear export, and that CNOT6 binds CNOT8 in yeast two-hybrid assays.
18818012 hCCR4/cNOT6 targets DNA-damage response proteins
18180299 CCR4 plays a role in the regulation of certain endogenous RARalpha target genes and RCD1 and CCR4 might mediate their function through their interaction with NIF-1
12771185 CCR4 and BTG2 interact and have a role in cell-cycle regulation

AA Sequence

MPKEKYEPPDPRRMYTIMSSEEAANGKKSHWAELEISGKVRSLSASLWSLTHLTALHLSDNSLSRIPSDI      1 - 70
AKLHNLVYLDLSSNKIRSLPAELGNMVSLRELHLNNNLLRVLPFELGKLFQLQTLGLKGNPLTQDILNLY     71 - 140
QEPDGTRRLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYNVLCDKYATRQLYGYC    141 - 210
PSWALNWDYRKKAIIQEILSCNADIVSLQEVETEQYYSFFLVELKERGYNGFFSPKSRARTMSEQERKHV    211 - 280
DGCAIFFKTEKFTLVQKHTVEFNQLAMANSEGSEAMLNRVMTKDNIGVAVLLELRKESIEMPSGKPHLGT    281 - 350
EKQLILVANAHMHWDPEYSDVKLVQTMMFLSEVKNIIDKASRNLKSSVLGEFGTIPLVLCADLNSLPDSG    351 - 420
VVEYLSTGGVETNHKDFKELRYNESLTNFSCHGKNGTTNGRITHGFKLQSAYESGLMPYTNYTFDFKGII    421 - 490
DYIFYSKPQLNTLGILGPLDHHWLVENNISGCPHPLIPSDHFSLFAQLELLLPFLPQVNGIHLPGRR       491 - 557
//

Text Mined References (27)

PMID Year Title
26792405 2016 miR-29c-3p promotes senescence of human mesenchymal stem cells by targeting CNOT6 through p53-p21 and p16-pRB pathways.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944446 2015 The enzyme activities of Caf1 and Ccr4 are both required for deadenylation by the human Ccr4-Not nuclease module.
22977175 2012 The structural basis for the interaction between the CAF1 nuclease and the NOT1 scaffold of the human CCR4-NOT deadenylase complex.
21981923 2011 GW182 proteins directly recruit cytoplasmic deadenylase complexes to miRNA targets.
21233283 2011 The Ccr4a (CNOT6) and Ccr4b (CNOT6L) deadenylase subunits of the human Ccr4-Not complex contribute to the prevention of cell death and senescence.
20595389 2010 MAPKAP kinase 2 blocks tristetraprolin-directed mRNA decay by inhibiting CAF1 deadenylase recruitment.
20065043 2010 CCR4-NOT deadenylates mRNA associated with RNA-induced silencing complexes in human cells.
19946888 2010 Defining the membrane proteome of NK cells.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
More...